KEGG   Gossypium raimondii: 105786044Help
Entry
105786044         CDS       T04129                                 

Definition
(RefSeq) probable protein S-acyltransferase 23
  KO
K20032  palmitoyltransferase ZDHHC13/17 [EC:2.3.1.225]
Organism
gra  Gossypium raimondii
Brite
KEGG Orthology (KO) [BR:gra00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gra04131]
    105786044
Enzymes [BR:gra01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     105786044
Membrane trafficking [BR:gra04131]
 SNARE
  SNARE associated proteins
   Palmitoyltransferases
    105786044
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 DHHC Ank_4 Ank_3 Ank_5 Ank Dynactin_p62
Motif
Other DBs
NCBI-GeneID: 105786044
NCBI-ProteinID: XP_012467749
UniProt: A0A0D2ME21
Position
2
AA seq 544 aa AA seqDB search
MASSEIEVVPSESEPKTTQQQNSTQQIAIIDVFSASAYGDFDKLRKFVEEDGASLATPDG
NSYYALQWAALNNFSDIAQYIIDHGGNVNATDNNQQTALHWAAVKGSIAVADVLLQNGAR
VEAADLNGYRAVHIAAQYGQTAFLNHIVAKYHAEYDAPDNCGRSPLHWAAFKGFSDTIRL
LLFRDAFQGKQDIEGCTPLHWAALRGNVEACMVLVHAGTKQELLVKDKAGNTPLKLASDK
GHRQIALLLSKAERANSKRLFDKIHGGKMGEVGYAPILFCVIIVLIILFINSVLATPTLP
KVTAIVGLWGWTGVSLGIGSLIMFYRCCSKDPGYIKKSRRLDGYEDTEDPLLNIELNNAS
VWTGNWDQLCPTCKIIRPVRSKHCPICKHCIEQFDHHCPWISNCVGKRNKWDFFVFICMG
TLTSFIGAFVAVQRIWTAIPALSAGKTWIHLVIDHHPGIVAFLLLDALVLTSATTLTIIQ
ATQIARNITTNEVSNAIRYRYLHGPEGRFRNPYNHGCRKNCTDFFIRGYTDDEIAWPPLQ
SVAS
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atggcttcttcagagatcgaggtggtaccatcagaatcagaaccgaaaacaacccaacaa
caaaactctactcaacaaattgctattatcgacgtcttctcggcctctgcctatggagat
tttgacaaactgagaaaattcgtagaagaagatggtgcctcactcgcaacacctgacggt
aacagctattacgcccttcagtgggctgctcttaacaacttctcagatattgctcagtac
attatcgatcatggtggaaatgtaaatgcaactgacaataaccagcagacagctctgcat
tgggctgcagttaagggttcgattgctgtggcagatgtgctcttgcaaaatggagctcgg
gtggaagcagctgatctcaatggttatcgtgcagttcatattgctgctcaatatgggcaa
acagctttcttaaatcatattgttgcaaaatatcacgcagaatatgatgcacctgataac
tgtggaaggtcgccacttcattgggctgcattcaagggattttcagatacaattagattg
cttctatttcgagatgcgtttcaagggaaacaagacatagaaggttgcactccattgcac
tgggctgcactaagaggaaatgtagaggcatgcatggttctcgtgcatgcaggcacaaag
caggaattattggtaaaagataaagctggaaacacccctcttaagcttgcatctgataaa
ggtcatcggcagattgcccttctcctttctaaagcagaaagagccaatagcaaacggttg
ttcgacaaaattcatggtgggaagatgggggaagttggttatgctcccatattattttgt
gttatcattgttctaattatcctcttcatcaactcagttcttgctactccaactcttcct
aaggtaactgccattgttggactttggggatggactggtgtctctcttggtattggctcg
ttgataatgttctacaggtgttgtagcaaagatccaggttatataaaaaaatctagaaga
ttggatggctatgaagatacagaggatcccttgctgaatattgagctgaacaacgcatct
gtatggacaggaaactgggatcagctttgccctacctgcaagataataagacctgtacgt
tctaagcactgtcctatctgtaagcactgtattgaacagtttgaccatcattgcccatgg
atatctaactgcgtaggaaagagaaacaaatgggatttctttgttttcatatgtatggga
accttgacttcattcattggtgcctttgttgcagttcaaaggatatggacagcaatacct
gcattgtctgctggtaaaacatggattcatcttgtgattgatcatcatcctggtattgtt
gcatttctccttttggatgctcttgttttgacttctgctacaactttgaccataatacag
gcaacccagatagctcggaatatcaccactaacgaagtatcaaacgccattcgctatcgg
tatctccatggccccgaaggacggtttcggaacccatataaccatggttgccgaaagaat
tgtacagatttcttcattcgtggttacacagatgatgagattgcttggcctccattacag
agtgttgccagttag

DBGET integrated database retrieval system