KEGG   Gossypium raimondii: 105786363
Entry
105786363         CDS       T04129                                 

Definition
(RefSeq) delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
gra  Gossypium raimondii
Pathway
gra00100  Steroid biosynthesis
gra01100  Metabolic pathways
gra01110  Biosynthesis of secondary metabolites
Module
gra_M00917  Phytosterol biosynthesis, squalene 2,3-epoxide => campesterol/sitosterol
Brite
KEGG Orthology (KO) [BR:gra00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    105786363
Enzymes [BR:gra01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     105786363
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 105786363
NCBI-ProteinID: XP_012468202
UniProt: A0A0D2QIC8
Position
2
AA seq 369 aa
MDLGFLLQALIPSWNSVAVLLIFFAYLAIAGSILPGKLVPGVTLQDGSRLYYRCNGLRAL
LLLVGLLGIGSKMNFVSPTVISNRGLELLSTTFIFSFLTMVVLYAAGCRSCSKGSSLKPH
ITGNLIHDWWYGIQLNPQFMGIDLKFFFVRAGMMGWLIINLSVLAKSVQDGSLSQSMILY
QLFCAFYILDYFVHEEYMTSTWDIIAERLGFMLVFGDLVWIPFTFSIQGWWLLNNKVELT
TAAAIANCFVFLIGYLVFRGANKQKHIFKQNPKALIWGKPPKVIGGKLLASGYWGIARHS
NYLGDLLLALSFSLPCGLSSPIPYFYPIYLFILLVWRERRDEARCAEKYKDIWAEYCRLV
PWRIFPYLY
NT seq 1110 nt   +upstreamnt  +downstreamnt
atggatctgggttttcttctacaggctttaattccctcttggaactctgttgctgtattg
ttgatattctttgcttacttagctattgctggatctatattacctggaaaacttgttcct
ggagtcacattacaagacgggtctcgtctctattaccgctgcaatggattgcgagcactc
cttttgttagttgggctccttgggattgggtctaagatgaattttgtatcaccaactgta
atatccaacagaggacttgagctgttatcgacaactttcatattcagttttcttacaatg
gtagtactctatgctgctggctgcaggtcatgcagtaaaggttcttcattaaagcctcac
atcacagggaacctgatacatgactggtggtacggaatacagcttaatcctcagtttatg
ggtattgatctcaagttcttctttgttagagctggaatgatgggatggctaatcatcaat
ctatcagttcttgcaaaaagtgttcaagatggctctttaagccaatcaatgatcctttac
cagttattctgtgcgttctacatcctggactattttgtgcatgaggagtacatgacctcc
acttgggacataattgccgagaggttaggcttcatgttggtgtttggagatctagtgtgg
attcccttcacatttagcatccagggttggtggcttttgaataacaaagtggagctgaca
acagccgctgcaatagcaaattgttttgtttttctgatcgggtatcttgtatttagagga
gccaataagcaaaagcatatattcaaacagaacccaaaagcgcttatatggggtaaacct
ccaaaggttatcggcggaaagctgcttgcttccggttattggggaattgcaaggcactca
aattacctcggggatttgttgctggctttatctttcagtttaccttgtggattaagttcc
ccaattccgtacttctacccgatttatctgtttattctattggtatggagggaaagacgc
gacgaagcacggtgtgcagagaagtacaaagatatatgggcagaatattgtaggcttgta
ccgtggagaatatttccatatctgtattag

DBGET integrated database retrieval system