KEGG   Gossypium raimondii: 105786368
Entry
105786368         CDS       T04129                                 

Definition
(RefSeq) delta(14)-sterol reductase-like
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
gra  Gossypium raimondii
Pathway
gra00100  Steroid biosynthesis
gra01100  Metabolic pathways
gra01110  Biosynthesis of secondary metabolites
Module
gra_M00917  Phytosterol biosynthesis, squalene 2,3-epoxide => campesterol/sitosterol
Brite
KEGG Orthology (KO) [BR:gra00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    105786368
Enzymes [BR:gra01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     105786368
SSDB
Motif
Pfam: ERG4_ERG24
Other DBs
NCBI-GeneID: 105786368
NCBI-ProteinID: XP_012468210
Position
2
AA seq 196 aa
MDLGFLLQALIPSWNSVAVLLIFFAYLAIAGSILPGKLVPGATLQDGSRLYYRCNGLRAL
ILLVGLLGIGSKMNFVSPTVISDRGLELLSATFIFSFLTMVVLYAAGCRSCSKGSSLKPH
ITGNLIHDWWYGIQLNPQFMGIDLKFFFVRAGMMGWLIINISVLAKIVQDGSLSQSMILY
QLFCAFYILDYFVHEE
NT seq 591 nt   +upstreamnt  +downstreamnt
atggatctgggttttcttctacaggctttaattccctcttggaactctgttgctgtattg
ttgatattctttgcttacttagctattgctggatctatattacctggaaaacttgttcct
ggagccacattacaagacggctctcgtctctattaccgctgcaatgggttgcgagcactc
attttgttagttgggctccttgggattgggtctaagatgaattttgtatcaccaactgta
atatctgacagaggacttgagctgttatcggcaactttcatattcagttttcttacaatg
gtagtactctatgctgctggctgcaggtcatgcagtaaaggttcttcattaaagcctcac
atcacagggaacctgatacatgactggtggtacgggatacagcttaatcctcagtttatg
ggtattgatctcaagttcttctttgttagagctggaatgatgggatggctaattatcaat
atatcagttcttgcaaaaattgttcaagatggctctttaagccaatcaatgatcctttac
cagttattctgtgcgttctacatcctggactattttgtgcatgaggagtag

DBGET integrated database retrieval system