KEGG   Gossypium raimondii: 105787995Help
Entry
105787995         CDS       T04129                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme CWINV1
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
gra  Gossypium raimondii
Pathway
gra00052  Galactose metabolism
gra00500  Starch and sucrose metabolism
gra01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gra00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    105787995
   00500 Starch and sucrose metabolism
    105787995
Enzymes [BR:gra01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     105787995
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 105787995
NCBI-ProteinID: XP_012470106
UniProt: A0A0D2MJW1
Position
3
AA seq 572 aa AA seqDB search
MANSCVGLFLFFALFLSHGIVELEASHHVYRNLQTVQSAASTDQPYRTGFHFQPPKNWIN
DPNGVMVYKGLYHLFYQYNPKGAVWGNIVWAHSTSKDLVNWTPHEPAIFPSQPSDINGCW
SGSSTILPGGKPAMLYTGIDTKNSQVQNLAVPKNLSDPYLREWVKSPKNPLMQPTAQNQI
NASSFRDPTTAWLGPDKKWRVIIGSKIDRQGLVILYKSKDFVNWVQAPMPLHSAKDTGMW
ECPDFYPVPVSGKNGVDTSLNGPYVKHVLKISLDDTKHDLYTIGSYDSLKDIYIPDKGSV
ENDSGLRYDYGKYYASKTFLDSIKNRRILCGWLNESSSVADDIKKGWAGVHAIPRQVWLD
KSGKQLIQWPVAEIQKLRTNHVSLPSRLLKGGSVVEVSGVTASQADVDISYKISDFEKAE
VLNPSWTNPQLLCSQKGASVKGGVGPFGLLVLASKGLTENTAVFFRIFKGQNKYVVLMCS
DQSRSSLKANDKTTYGAFLDVDPLHQSLSLRSLIDHSIVESFGGGGKACMSARVYPTLAI
NNAAHLYVFNNGSEAVEISKLNAWSMKKAIIN
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atggctaactcttgtgttgggttgtttttgttctttgctctctttcttagccatgggatt
gtggaacttgaagcttcacatcatgtttacagaaaccttcaaactgttcaatctgccgca
tctacagatcaaccttacagaactggctttcattttcaacctcccaagaactggataaat
gatcctaatggggttatggtttacaagggactttatcatctattctaccaatacaatcca
aaaggtgcagtgtggggcaacattgtctgggctcactctacatcaaaagatcttgtgaat
tggacccctcatgagccagctatctttccctcccaaccatctgatattaatggttgttgg
tccggttcatccacaatcctccccgggggcaaaccagccatgctttacaccggaattgac
accaaaaacagccaagtccagaatcttgccgtccccaagaatctatccgatccttacctc
agagaatgggtgaagtcaccaaagaaccctttgatgcaacccactgcccaaaaccagatt
aatgcaagttctttcagagatcccaccactgcttggttaggccctgacaagaaatggagg
gtaatcattggaagcaagattgaccgccagggcttagtcatcctttacaaaagcaaagac
tttgtgaattgggtccaagcccctatgcctttgcattcagctaaagacaccgggatgtgg
gaatgccctgacttttaccccgttcctgtcagtggcaaaaacggtgtcgacacttctctt
aatggtccatatgtcaagcatgtccttaagatcagcttagatgacacaaagcatgatctt
tacactattggctcatatgatagcttgaaggacatctatataccagacaagggatccgta
gagaatgattcaggcttgagatatgattatggaaaatattatgcttccaagacattctta
gacagtatcaaaaacaggagaatcttatgcggttggttgaacgaatcatccagcgtcgct
gatgatatcaagaaaggatgggcgggagttcacgcaattcctaggcaagtttggctggat
aaatctggaaaacaattgatacagtggccggtagcagaaatacaaaagctacgtacaaac
cacgtaagcttacccagcagattgctcaagggaggatcggttgttgaagtttctggggtt
actgcttcacaggcagatgttgacatttcatacaagatatctgactttgagaaagctgaa
gtgttaaacccaagctggaccaacccacagctactatgcagccaaaagggtgcatcagtg
aaaggcggtgttggtccatttgggttgctagttttagcttcaaaaggcttaactgagaac
acggcggtcttctttagaatattcaaaggccaaaacaaatacgtggtgctcatgtgcagt
gaccaaagcagatcctccctaaaagccaatgacaagaccacctatggggctttcttggat
gtggaccctcttcatcaaagcttgtcattgaggagtttgattgatcattcaatagtagag
agctttggtgggggtggcaaagcatgtatgtcagctagagtttatcccacattggcaatt
aataacgcagcccacttgtatgttttcaacaatggaagtgaagccgtggagatttcaaag
ttgaacgcttggagcatgaagaaagccataatcaattga

DBGET integrated database retrieval system