KEGG   Gossypium raimondii: 105788429Help
Entry
105788429         CDS       T04129                                 

Definition
(RefSeq) putative glycosyltransferase 5
  KO
K08238  xyloglucan 6-xylosyltransferase [EC:2.4.2.39]
Organism
gra  Gossypium raimondii
Brite
KEGG Orthology (KO) [BR:gra00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:gra01003]
    105788429
Enzymes [BR:gra01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.39  xyloglucan 6-xylosyltransferase
     105788429
Glycosyltransferases [BR:gra01003]
 Polysaccharide
  Structural polysaccharide
   105788429
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_34 Holin_BlyA
Motif
Other DBs
NCBI-GeneID: 105788429
NCBI-ProteinID: XP_012470784
UniProt: A0A0D2NYZ3
Position
3
AA seq 458 aa AA seqDB search
MGQDSFTPQKRSSTGGGLPTTNNAAAGGGRSRVLAGMPRGRQIHKTFNNIKITILCGFVT
ILVLRGTIGVGNLGSSEADAVNQNLIEETSRILAEIRSDSDPTDPDEPPETEINPNTTYT
LGPKISDWDQQRKVWLSENPEFPNFVNGKARILLVTGSPPNPCDNAIGDHYLLKAIKNKI
DYCRLHGVEIVYNMAHLDKELAGYWAKLPLIRRLMLSHPEVEWIWWMDSDAFFTDMVFEI
PLSKYDKYNLVVHGYPDLMFEQKSWIALNTGSFLFRNCQWSLDLLDAWAPMGPKGSIREE
AGKVLTANLKGRPAFEADDQSALIYLLLSQKEMWMDKVFLENQYYLHGYWAGLVDRYEEM
MEKYHPGLGDERWPFVTHFVGCKPCGSYGDYPVERCLRSMQRAFNFADNQVLKLYGFRHR
GLLGPNIKRIRNETVTPLEIVDELDIRRSTHEKTETRS
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgggtcaagacagtttcactccccaaaagagatcttccaccggcggcggcttacccacg
accaacaacgccgctgctggtggcggaagatcccgtgtattagccggaatgccgcgtggg
aggcagatccacaagaccttcaacaacattaaaatcacgatcctctgcggcttcgttacc
atacttgttctacggggtacaatcggcgttggcaatttgggaagctccgaagccgatgct
gttaaccaaaacctaatcgaagaaacgagccggatcctagctgagatccgctccgactcc
gaccctaccgatccggacgaacctcctgaaaccgagatcaatcccaatactacctacacg
ctcggacccaaaatctcggactgggaccagcaacgtaaggtttggctttcagaaaacccc
gaattccctaattttgttaatggcaaagctcggatcttacttgttactgggtcgccccca
aacccttgtgataatgctataggagatcattatttgctgaaagcgataaagaataagatc
gattattgtaggcttcatggggttgaaattgtttataatatggctcatttagataaggag
ttggctgggtattgggcgaaattgccattaattaggagattaatgttgtctcatcctgaa
gttgagtggatttggtggatggatagtgatgctttttttacagatatggtgtttgagatt
cctttgtccaagtatgataagtataatttggttgttcatggttaccccgatttaatgttt
gagcagaagtcgtggattgctttgaatacggggagtttcctgtttaggaactgccagtgg
tcgttggatttgcttgacgcgtgggcgccaatgggacctaagggttctattcgtgaggaa
gccgggaaggttttgactgctaacttgaaaggaaggccggcgtttgaagccgatgaccag
tcagctttgatttacttgttgctttctcaaaaggaaatgtggatggataaagtgtttctc
gagaatcagtattatttgcatggttattgggcaggtttggttgataggtacgaggagatg
atggagaaatatcatccaggtttgggagacgagaggtggccgtttgtgactcatttcgtt
ggttgcaagccctgtgggagttacggagattaccctgtcgagaggtgtttgcgcagtatg
caaagggcattcaactttgccgataaccaggtgcttaagctgtacgggtttagacataga
ggattgttaggccccaatattaagaggatcaggaacgagacggtgactcctttggaaatc
gttgatgagcttgatattcgacgatcaacgcacgagaaaaccgaaacacggagctag

DBGET integrated database retrieval system