KEGG   Gossypium raimondii: 105791673Help
Entry
105791673         CDS       T04129                                 

Definition
(RefSeq) GATA transcription factor 4
Organism
gra  Gossypium raimondii
SSDB OrthologParalogGFIT
Motif
Pfam: GATA
Motif
Other DBs
NCBI-GeneID: 105791673
NCBI-ProteinID: XP_012475317
UniProt: A0A0D2S0Q5
Position
4
AA seq 255 aa AA seqDB search
MDIYGISTSEQLDVDDLLDLSNDEFFPSASAATSHDQFPPSETHFSDASAASSSSAALTP
SFSLDFNHDICLPSDDVAELEWLSQFVEDSFTDFPSYSLPGILNPRNDNSSFSSKARSKR
SRAVTTLNGTNWTTTTSGAAGTLTGKTKTKREIQRQASPAAVEGMRRCSHCASEKTPQWR
TGPLGPKTLCNACGVRYKSGRLVPEYRPAASPTFVLTQHSNSHRKVLELRRQKEEQSTRR
QQEQVCRQQHRQQVC
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atggatatctatgggatttcaacttcggaacaattagatgttgatgatcttttggatttg
tccaacgatgagttttttccctctgcttcggccgccaccagccatgatcagttccctcct
tctgagacccatttcagcgacgcttccgccgcttcctcctcctctgccgccctcactccc
tctttctccttagactttaaccacgatatttgccttcctagtgatgacgtggctgagctg
gagtggttgtcgcagttcgttgaagattccttcaccgacttcccctcatactcgctcccc
ggaatccttaaccctagaaatgataactcgtcgttttctagcaaagctcggagcaagcgt
tccagagcggtaacaacattgaacggcacaaactggacgacgacgacgtctggagcggca
ggtaccttaacgggaaaaacaaagacaaaaagggaaatccaacgtcaagcatccccggca
gcggtagaagggatgaggcgatgctcacactgcgcgtcggagaagaccccacagtggcgg
acggggccattaggaccgaagacattgtgcaacgcgtgtggggtccggtataaatcgggt
cggctagtgcccgaatacagacccgcagcgagtccgacatttgtgctgactcaacactcg
aactcccaccggaaggtgttggagctgcggcggcagaaggaggagcagtcgacgagacgg
cagcaagagcaagtgtgtcgtcagcagcaccgacaacaggtgtgctga

DBGET integrated database retrieval system