KEGG   Gossypium raimondii: 105792468Help
Entry
105792468         CDS       T04129                                 

Definition
(RefSeq) nicotianamine synthase-like
  KO
K05953  nicotianamine synthase [EC:2.5.1.43]
Organism
gra  Gossypium raimondii
Brite
KEGG Orthology (KO) [BR:gra00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    105792468
Enzymes [BR:gra01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.43  nicotianamine synthase
     105792468
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAS Methyltransf_31 CheR Methyltransf_25 Methyltransf_23 Methyltransf_12 PARP_regulatory
Motif
Other DBs
NCBI-GeneID: 105792468
NCBI-ProteinID: XP_012476513
UniProt: A0A0D2R2Z1
Position
4
AA seq 318 aa AA seqDB search
MVCEKDPLVQKVCELYEQISSLESLKPCKDVNMLFTQLVVTCMPPSPIDVTKLCKSIQDI
RCKLIRLCGEAEGHLESHFSTILGSYDNPLHHLHIFPYYSNYLKLSQLEFNILTKHCSNL
PTKVAFVGSGPLPLTSIVLASFHLTTTSFHNYDIDPSANSMALQLVSSDPDLSQRMFFHT
SDIMDITNDLKDYDVVFLAALVGMDKETKVRVIDHVAEYMAPGALLMLRSAHGARAFLYP
VVDPCDLRGFEVLSIFHPTDEVINSVVIARKIPITKQCSVEYPLAPTKLPNKCFDIEMFN
PLNHVNLLEELDIEEQLS
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atggtttgcgagaaagatcccttggtacaaaaggtctgcgagttgtatgagcaaatctca
agcctcgagagtctcaaaccttgcaaagatgtcaacatgctcttcacacaacttgttgtc
acatgcatgccacccagccctatcgatgttaccaagctttgcaaatcaattcaagacatc
aggtgtaagttgattcgactatgtggagaagctgagggacacttggagagccatttctca
accatcttgggatcctatgataaccctcttcaccatcttcacattttcccttactattct
aactatcttaagcttagccaacttgaattcaatatccttaccaaacactgctctaatctc
cctacgaaagttgcctttgttggttccggtcctcttcccctcacctcaattgtgttggct
tcattccatcttaccaccacctctttccacaactatgatatcgacccttcagccaattcc
atggctcttcaactggtttcatctgaccctgatttatctcaaaggatgttctttcacact
tcagatataatggatattacaaatgatttgaaggactatgatgttgtgttcttggcggct
cttgtggggatggacaaggaaacaaaagttcgtgtcatcgatcatgtggctgagtacatg
gcccctggggctcttttgatgctgaggagtgctcatggtgctagggctttcctttatcca
gttgttgatccatgtgatctacgcggatttgaggtcctctccatattccatcccactgat
gaagtcattaactctgtggtcattgcacgtaaaattccaatcactaaacaatgctccgtt
gagtaccctcttgccccaacaaagcttcccaacaagtgttttgacattgaaatgttcaat
cccctcaaccatgtcaacctgttggaggaacttgatattgaggaacaactctcctga

DBGET integrated database retrieval system