KEGG   Gossypium raimondii: 105794440Help
Entry
105794440         CDS       T04129                                 

Definition
(RefSeq) putative 1-phosphatidylinositol-3-phosphate 5-kinase FAB1C
  KO
K00921  1-phosphatidylinositol-3-phosphate 5-kinase [EC:2.7.1.150]
Organism
gra  Gossypium raimondii
Pathway
gra00562  Inositol phosphate metabolism
gra01100  Metabolic pathways
gra04070  Phosphatidylinositol signaling system
gra04145  Phagosome
Brite
KEGG Orthology (KO) [BR:gra00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    105794440
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    105794440
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    105794440
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gra04131]
    105794440
Enzymes [BR:gra01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.150  1-phosphatidylinositol-3-phosphate 5-kinase
     105794440
Membrane trafficking [BR:gra04131]
 Endocytosis
  Macropinocytosis
   Kinases
    105794440
 Endosome - Golgi transport
  Others
   Others
    105794440
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PIP5K Cpn60_TCP1 Glycos_transf_1 SUB1_ProdP9 Laminin_II
Motif
Other DBs
NCBI-GeneID: 105794440
NCBI-ProteinID: XP_012479067
Position
5
AA seq 1658 aa AA seqDB search
MIIGVDKELFQGLINCLDLILRMMSTKFCKFCCDGVNVRCESRGMKYCDKVHPSLCESSE
PPSPCFVNPETIKSDSLAPYLEAYDCEFTMQSVTSKSITSFSTHSSPVSICRSACRCRSD
EEDAHDFGKHFLSPSTKYCQDVSNVDSHSLSGRHDFYSCKSVGSSPSVSPFRNNFTPYRV
GISLQKKQEGSPMAQYVGPFYQENMDALRKPNIGTEEPDNIYDYSDDFIFQNQNEKSQKL
LDFENNGLIWFPPPPEDENDEIESNFFTYDDEDDDIGDSGAMFSSSSSLSSMFPAREKQN
EGNKEPLRAIIQGHFRALVLQLLLGEGIKVGKEDNAGDWLDIITRIAWQAAKFVKPDTSK
GGSMDPGDYVKVKCIASGNPSESTLVKGVVCSKNIKHKRMTSQYKNPRLLLLGGALEFQK
VPNQLASFSTLLQQENDHLKMIIAKIKALHPNVLLVEKSVSSYAQEYLLEKEISLVLNVK
RRLLERIARCSGALVCPSIDNLSIARLGHCELFRVKKVSEEHEISNQLNKKPSKTLMFFE
GCPRRLGCTVLLRGRSREELKKVKHVVQYAIFAAYHLSLETSFLADEGATLPKMKVKHSI
IRPEKMQSDNVILVAPSSFYPSNFNAIGNSFAQNDASPSLNPKQGGLESFPNQDDQIHIS
PSFGGSILGTCNDDLTPIVDMDLCSLEQLSRLQMPPMFPCDIRDFPQSEMRETMTEEERH
NMHELEKSEKIIEDEASSGCFLATDTHQSILVSFSSRCVLKGTVCERSRLFRIKFYGSFD
KPLGRYLQDDLFDQAFCCQSCNEPTEAHVICYTHRQGNLTINVRRLSSLKLPGERDGKIW
MWHRCLRCVHIDGVPPATHRVVMSDAAWGLSFGKFLELSFSNHATANRVATCGHSLQRDC
LRFYGFGNMIAIFRYSPIDILSVHLPPSMLEFSGDIQQEWIRKEAAELMVKVEMLYAEVL
DVLDNIEQKNNSSNASDLSNRIMELRDQIQKERNDYISLLQPTVIETSHLDLTATDILEL
NRLKRSLLIGLHVWDRRLNSLDSHLRKGSAFKGELGLSKDGKLDAYQQNTYKSADSLEPP
KSDARLEQNSSLPTFESDVPKELDLALCIENREENEETDESIHYPTSTLSERIDSAWTST
DLLTLKVQSPEAFQGNELQTRLVKPTSKIDNLPLRKVASPTRVHSFDSALRLQARIQKGL
HPSTLHLSTLKSFHATRDYRTMVRDPVSNVTSTYSYTFPFEAQKLNLLLRSTPTLINCAS
HVAEGARLLLVQRGPSDIVIAVYDNDPASIISYALISKEYEEWVDDKSIKIGGGWSVADR
SKKDSATSSFSPWQSFGSLDMDYTHFGSFGSEDTSSSIGAMFTNTKRSPHLTVCFEDDSY
VGGGMVKFSVTCYFAKQFDSLRRKCCPNEVDFVRSLSRCQKWSAQGGKSNVFFAKSLDER
FIIKQVQKTELESFNEFAPEYFKYLSDSLSSGSPTCLAKILGIYQVSVKYLKGGKETKMD
LVVMENLFFRRSISRTYDLKGSARSRYNPDTLGRNKVLLDMNLLETLRTEPIFLGSKAKR
ILERAIWNDTSFLASIAVMDYSLLVGVDEEHKELVLGIIDFMRQYTWDKHLETWVKASGI
LGGPKNASPTIISPKQYKKRFRKAMTTYFLTVPDQWTL
NT seq 4977 nt NT seq  +upstreamnt  +downstreamnt
atgataataggggttgataaagaactctttcaggggttgatcaactgtttggatctaatt
ttgaggatgatgagtactaaattttgcaagttttgttgtgatggggttaacgtgaggtgt
gaaagtagaggaatgaagtactgtgataaagtgcatccctctctctgtgagagctcggaa
ccaccgtccccatgttttgtgaatcccgaaaccatcaaaagtgatagtcttgccccatat
cttgaagcttatgattgtgagtttacaatgcaatcggtaacaagcaagagtataacttct
tttagtactcattcttctccagtatctatttgccgatctgcctgcaggtgtaggagtgat
gaagaagatgctcatgattttggtaagcattttttgagcccttcaaccaaatattgtcaa
gatgtttcaaatgtagattcacatagtcttagtggtagacatgacttttatagttgtaag
tctgtgggatcaagtccttcagttagcccctttaggaacaattttactccttatagagtt
gggatttctctacagaagaagcaagaagggagcccgatggctcaatatgttggtcccttt
tatcaagaaaacatggatgctttaagaaagccaaatatagggaccgaggaacctgataat
atttatgattactctgatgattttattttccaaaatcaaaatgaaaagtcacaaaagctt
ttggattttgaaaacaatggcctaatatggtttccaccaccacctgaggatgaaaatgat
gagatagagagtaacttcttcacatatgatgatgaagatgatgatattggggattctggt
gcaatgttctcatcaagtagtagcctttcaagtatgttcccagcaagggagaaacaaaat
gagggaaacaaagagccccttagggctataatacaagggcattttagggctttggtgttg
cagcttttactaggtgagggtatcaaagttggtaaagaggataatgctggggattggctt
gacattatcacaaggattgcatggcaagctgcaaaatttgtgaaaccagataccagcaaa
ggaggcagtatggatcctggggattatgtaaaggttaagtgcatagcgtcaggaaatccc
agtgaaagcacccttgtcaagggagtggtatgttccaaaaatataaaacacaagcgcatg
acctcacaatacaaaaatcctagattacttcttttaggaggagcccttgaatttcagaaa
gttccaaatcagctggcatcttttagcacattacttcaacaggaaaatgatcatctcaag
atgatcattgcaaagattaaggctcttcaccccaatgttttgcttgtagaaaagagtgtg
tcttcatatgcccaagagtatctgcttgaaaaggaaatatcattagttctcaatgtgaaa
aggcgattattagagcgtatagcaaggtgtagtggcgctcttgtttgtccatcgattgat
aatttatctattgcacgattgggccactgcgaattatttcgagtcaagaaagtatcagaa
gaacatgagatttccaatcaattgaacaagaaaccatcaaaaacattgatgttctttgaa
ggttgtcccagacgcttaggttgcacggtcttgttgagaggcagatctcgtgaagaacta
aaaaaggttaaacatgttgtccaatacgctatttttgcagcttatcacttatcgcttgaa
acttccttccttgctgacgaaggtgctactctgcctaagatgaaagtaaaacattcaatt
attagaccagagaaaatgcagtctgacaatgtcattttagttgcccctagttccttttat
ccttccaatttcaatgcaataggcaattcctttgctcaaaatgatgcatctccaagtctt
aatccaaagcaaggaggcttagaatcatttcctaatcaggatgatcaaattcatatttcc
ccatcttttggtggttctattcttggtacatgcaatgatgatttaacacctattgttgat
atggatttgtgttctttggaacaattgagtcgtttacaaatgccccctatgtttccctgt
gatattagagattttccccaatctgaaatgcgagaaactatgactgaagaggagaggcat
aatatgcatgaattggaaaaatctgaaaagattatagaagatgaagcttccagtggatgt
tttttagccactgacacacaccagagtatattggtttcattttcaagtcggtgtgttcta
aaaggaactgtgtgtgaacgttcacgactttttcgaataaagttctatgggtcttttgat
aaaccactgggaagataccttcaagatgacttgtttgatcaagcattttgttgccaatca
tgcaatgagccgactgaagctcatgtcatatgttatactcaccggcaaggaaacctgaca
atcaatgtaaggcgcctttcctctcttaagctacccggtgaacgagatgggaagatatgg
atgtggcacagatgccttaggtgtgttcatattgatggggttcctccagcaactcataga
gtggttatgtctgatgctgcttggggactttcttttggaaagtttttggagcttagtttt
tcaaatcatgcaactgctaatcgtgttgcaacttgtggtcattccttgcagagggactgc
cttcgtttctatggatttggcaacatgatagcaatttttcgctattccccaattgatata
ctatcagtacatttgccgccgtcaatgcttgagtttagtggggatattcaacaagagtgg
ataagaaaagaggcagctgagctaatggtcaaagtggaaatgttatatgcggaggtactg
gatgtacttgacaacattgaacaaaagaataattcatcaaatgcaagtgacttatcaaat
cgtattatggaactaagagatcagattcaaaaggagagaaatgattacattagtttgtta
caaccaactgttatcgagacatcacaccttgatctgacagctacggacatcctagaactg
aatcgcttaaagcgttcacttctaattggtttgcatgtatgggatcgacgacttaattca
ttggattcccatcttaggaaaggttctgcattcaaaggtgaacttggtctctccaaggat
gggaaacttgatgcttatcaacaaaacacctacaaatccgcagattcactggaacctcct
aaaagtgacgcacgattggagcaaaactctagtttgccaacctttgaatctgatgtgcca
aaagaattggaccttgcattgtgtattgaaaatagagaggagaatgaggaaacagatgaa
agcatccattatcctacatctactttatctgaaagaatagattctgcttggacaagtact
gatctacttacattaaaagttcaatctccagaagcatttcagggaaatgagctccaaact
cgtttggtcaagccaacaagtaaaatcgataatcttcctttgagaaaggtagcttctcca
acgagggttcattcttttgattctgcattgagactccaagcaagaattcagaaaggattg
cacccctcaacattgcatttatcaacacttaaatcatttcatgctactagagattatagg
actatggtgagagatcctgtttctaatgtgacaagtacctactcttatacatttccattt
gaggcacaaaagttgaatttgttacttcgatccacacccacgttaatcaattgtgcatct
catgtggctgaaggggctcggctacttcttgtgcaaaggggtcctagtgatattgttatt
gcggtttatgacaatgatcccgcaagtataatatcatatgcccttatttcaaaagaatat
gaagaatgggttgatgataagtccattaaaataggaggaggttggagtgttgctgatagg
agcaaaaaagattctgcaacttccagcttttcaccctggcagtcatttggttcacttgac
atggattatacacattttggaagttttggctctgaagatacttcatcttccattggtgcc
atgtttactaatacaaaaaggtctccacatttaacagtttgttttgaagatgactcttat
gttggtggtggcatggtgaagttttctgttacttgttattttgcaaaacaatttgattct
cttagaagaaaatgttgccctaatgaagtggattttgtacgttccttaagtcgctgtcag
aaatggagtgcacaaggaggaaagagcaatgtgttttttgccaaatcgttagatgagaga
ttcattataaagcaagtacaaaaaacagagctagaatcttttaatgaatttgcaccagag
tacttcaagtatttgtctgattctcttagctcaggaagcccaacttgccttgccaaaatt
cttggtatttatcaggtatctgtaaaatacttgaaaggtgggaaagaaacaaaaatggat
cttgtggtgatggagaacttatttttcagaagaagtatatctaggacttatgatctcaag
ggctctgcaagatcacgatataatccagacacattaggaagaaacaaagtactattagac
atgaatttgttagaaacattgcgaacagagcctatttttcttggaagcaaggcaaagaga
attctcgagagagctatttggaatgacacgtcttttttggcatctatcgcagtcatggac
tactcgttattggttggagtggatgaggagcacaaggagcttgtattaggaatcattgat
ttcatgagacaatatacctgggacaagcacttggagacatgggttaaagcatctgggata
ctaggtgggccaaaaaatgcatccccaacaattatttctcccaaacaatacaagaaaagg
ttccgaaaagcaatgactacatattttctcacagtacctgatcaatggactttgtga

DBGET integrated database retrieval system