KEGG   Gossypium raimondii: 105798861Help
Entry
105798861         CDS       T04129                                 

Definition
(RefSeq) Fanconi anemia group I protein
  KO
K10895  fanconi anemia group I protein
Organism
gra  Gossypium raimondii
Brite
KEGG Orthology (KO) [BR:gra00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:gra03400]
    105798861
DNA repair and recombination proteins [BR:gra03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    FANCD2-I complex
     105798861
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FANCI_S4 FANCI_HD2 FANCI_S2 FANCI_HD1 FANCI_S1
Motif
Other DBs
NCBI-GeneID: 105798861
NCBI-ProteinID: XP_012484535
UniProt: A0A0D2RYS1
Position
6
AA seq 1410 aa AA seqDB search
MATTESAAPPLNDVDIVHLAQRKQPSNSHQQSNVSLPPFLLSPHCHKDLLSYLHSRAASP
SPSSVVCEYVISLLSLISLSPGTPTVCSLLSSLLSSYTQLFPSLPHDSNSLRTIKNFNTL
LIHVPLEDLKLVIDLVASDLSGVVSVDDAQLFDLLPQCFELIRNAEEKGGDYVNSVVDKI
LDSKWSKGFLLKMVSIAKEFSFLDKTRGNEFLEKVFVGIKTVDLMDLPSLVYQLLVLASK
GFNKREIIEGIVYFFGSELGSKMASTVRQVEGTVLLHVNFAVKQDPSLGKEVMGLVKSDL
RAFNHFTVAVLLSVSRVRRFSESSMAILKTALLTAYRDYKFTKECKWIPDDIKGEYLKSV
KVVEKSVLRAVNESNYGREHMVPSILQFGFILLESVGEVNCKELGNSNGLLGIEELGIQM
LKTLFEVHDMARNEIMEQVKFRILSLKPELSRPILRLLCYLIQCYPYPMMEHIPRLKELL
DYFTFMDGKIASYLVSALLPLIRFSRDLRDYAILVVRKAVFRREEAVRVAATNSIIELIL
AEKQPKGDGLFFLQDSSSQASCSQQADIPCSMGGDLFQELSALLQRCLYQQAKVKQVVYQ
GLVKLVLADPAIGGLVFDFLLPHFLQFFKEGPDVQLGVSSCIKSENGKVLIQEPLDCLLS
CISWILLLQTHGKTDKLLDSIGACFGFSLSQENEDGRNMSTEVFSGAFLKIRKFLRNANL
EDILGQTHDASSAAVHEEKWKCSALILSGVIEVVLNTVAMDLEKAADQKVELEKEIMQFV
DRHDSLAKEASTSRQSNAGKRPNLRATAKDATDDIDSGNPKLIQEHTFFLATSSIHQLLL
MALKLYSSESSDIKATSQNHSQSSSSKTSKSCFKIISFALNASLHHVKSSAAVGNEGPMK
KLIYGEINMLGPPLLRLTLLLKPGSNVATSHRKKESKAKKDAEERKEHLLLALFCLKEMI
TVSLCGSCLTHLLENLLSVPELENADLHDECDQASEIDDQDIKNKELFIQKYLKPLLTDL
MKLSAFRTVEILCDILLMIGHKLPCKWRNSHGAWAIRMCKTNNTTNSSIAKSMVRLATSL
SSPPTDLLVAQEMLKELLKFIGPNNSDLSQVSEYLVVNQSTTIAIASCLLQITDNVIIDV
DWSTKKLKAASQVAQKTIHHDQNGEHNLGFTFEEIVYSRIKAVVEVLSSFVLMSLKDNQA
EHFLRLTARFYKNLALISKLKIAPKGQKQLLPSLQFQKLVELTCKELTVPLYNFVAEMQQ
AQQENANSKGMINKIKRENKCIPELIFQIEDYEKHLIRLSKATKMNLLKHAKRSTCRDFK
ILDPTTAVVGQAVPNNVGNDNDNENENENENENGRCSDSEDGNNDGNGSDKELSHEVESE
SDAVEDDRASVPTVKGVKRSRIVHDSDDDS
NT seq 4233 nt NT seq  +upstreamnt  +downstreamnt
atggccaccacggaatcggcggcgccgccgttaaacgacgtcgatatcgtgcatttagct
caacgaaagcaaccttccaacagccatcaacaatccaacgtttcactgcctccatttctc
ctctctcctcactgtcacaaggacctcctctcttacctccattcacgcgccgcctctcct
tctccctcctccgtcgtctgcgagtacgtcatctctcttctctccctcatttcactctct
cccggaacccccactgtctgttctttgctctcttctcttctctcatcatacactcaacta
ttcccttcgcttccccacgactcgaattccctcagaacaataaaaaatttcaacaccctt
ttgatccatgttcctttagaagacctcaagttggttattgatttggttgcatcagattta
tcaggggttgtttcagtggatgacgcccaactgttcgatcttttgccgcaatgtttcgag
ttgattcgaaacgcggaggaaaaaggtggggattatgtgaattccgtcgtggataagatt
cttgattccaaatggtcgaaaggatttttgcttaaaatggtttccattgccaaagagttt
agttttcttgataaaacgagagggaacgagtttttggagaaagttttcgtggggattaaa
actgtggatttgatggacttgccttcccttgtttatcagttgttagttttggcttcgaaa
gggttcaataaaagggagattattgaagggattgtgtacttttttgggtctgaattgggt
tcaaaaatggcttccactgttaggcaagttgaagggactgttttgttgcatgttaacttt
gcagtcaagcaggatccttctttggggaaagaggttatggggttagttaaatctgatctt
cgagcttttaatcatttcacggtggctgttttattgtcagtgtcaagggtacggaggttt
agtgaaagctcaatggctattttgaaaacagctttgcttaccgcataccgtgactataaa
ttcaccaaagaatgtaaatggataccggatgatattaagggagaatatctgaagagtgtt
aaagtggtcgagaagtccgtgttaagagctgtaaatgagagcaactatgggagggagcac
atggtgcctagtattttgcaatttggttttatcttgctagagtcagttggggaggtaaac
tgcaaagagctcggcaattctaatggtctccttggcattgaagagcttggtattcagatg
ctgaaaactctatttgaggttcatgatatggcaagaaacgagattatggagcaagtcaag
tttcgcattctctctttgaagccagagctgagtaggccaatattaaggctgctctgttat
ctcattcagtgttatccttaccctatgatggaacatattccccggcttaaggaattgctg
gattacttcactttcatggatggaaaaattgcctcttatcttgtcagtgcccttttgcct
ctcatcagattcagccgtgatcttcgggattatgctattttggttgtgcgcaaggctgtg
tttagaagagaagaagcagttcgtgttgcagcaacaaattccattatcgagcttatacta
gcggagaagcaacctaagggggatggcttgttttttctccaagactcgtctagccaagca
agctgcagtcagcaagctgacataccttgcagcatggggggagatctctttcaggagttg
agtgctttgctgcagagatgtctttatcagcaggcaaaggtgaagcaagttgtgtatcaa
ggactggtgaagctcgttctagcagatccggcaattggagggcttgtctttgattttctc
ttacctcattttctccagtttttcaaagagggtccggatgtccagcttggagttagctct
tgcattaaatcagaaaatggcaaagtacttattcaggagcccctggattgccttctttct
tgtatctcctggattttacttcttcagactcatggcaaaaccgataaacttttggattct
attggggcatgtttcggtttctccctctcgcaagagaatgaggatggcaggaacatgtct
accgaggtgttttccggtgcttttttgaagatccggaagtttctaagaaatgcaaatttg
gaagacattcttggtcaaactcatgacgcaagctctgcagctgttcatgaagagaaatgg
aaatgttctgcattgattttgtctggagttattgaagtggtattgaataccgttgcaatg
gatttggagaaagcagcagatcaaaaggttgaacttgaaaaggagattatgcagtttgtt
gaccgccatgattcattggcaaaggaggcaagtacttcaagacaaagcaatgctggcaaa
agaccaaatttacgagctactgctaaagatgcaacagatgacattgactcaggcaacccc
aaattgattcaagaacatacatttttcttggcaacttcaagcatccatcagttattgcta
atggcactgaagttatacagtagtgaaagctctgacataaaagcaacttcacagaatcat
agccagtcatcctcaagcaagacatcaaagagttgttttaagatcatttcatttgctttg
aatgcatcccttcatcatgtaaaatcttcagccgctgtgggaaatgaaggtccaatgaag
aagttgatctatggggaaatcaatatgctggggcctccattgctgagattaactcttctg
ctcaaacctggttcaaatgttgcaactagtcataggaaaaaagaaagcaaagcaaaaaag
gatgcagaggaaagaaaggaacatctccttctagcattattttgcttgaaagaaatgata
acagtcagtctatgtggttcttgtttgactcacttgcttgagaatctcttgtcagttcct
gaacttgagaatgctgatttgcatgatgaatgtgatcaagcctctgaaattgatgaccaa
gatataaaaaacaaagagctattcattcagaaatatttgaagccgctgctcactgatctt
atgaaactatcagcttttcggacggttgagattctttgtgatatcctgttgatgattggt
cacaaattgccctgcaaatggaggaactctcatggagcttgggctattcgtatgtgcaaa
accaacaacacaacaaattccagtattgcaaaaagcatggttagactagccactagtttg
agctcaccaccaacagatttgcttgtggctcaagaaatgttaaaggagctcttaaagttt
ataggaccaaacaacagtgacttatcgcaagtctcggaataccttgttgtaaaccagtca
acaaccattgctatagcttcttgtcttcttcaaataacagacaatgtcattatcgacgtg
gattggtcaactaaaaagctaaaggcagcttcacaagttgctcaaaagaccattcatcat
gaccagaatggagagcataatttgggtttcacatttgaggaaattgtatattcgaggatt
aaagccgttgttgaagtattatcttcctttgttttgatgagccttaaggataatcaagct
gagcattttcttagattaaccgcaagattttacaagaatttagctctgatttcaaagctc
aagattgcccctaaaggtcagaagcagcttttaccaagccttcaattccagaagcttgtc
gaattaacttgcaaggagctcaccgttccgctttataactttgtggcagagatgcaacaa
gctcaacaagaaaacgctaacagcaaaggaatgataaacaagatcaaaagggagaataaa
tgcatcccagagctgatattccagattgaagattatgaaaaacatctgattcgactcagc
aaagcaaccaagatgaacttattgaagcacgctaaacgcagcacttgtcgagacttcaaa
atcttggacccaacaacagctgttgtcggacaagctgttcccaacaatgttggaaatgat
aatgacaatgaaaatgaaaatgaaaatgaaaatgaaaatggaaggtgcagtgactctgaa
gatggaaacaatgatggcaatggatcagataaagagttgtcacatgaagtggagtctgaa
tctgatgccgtcgaagatgatagagctagtgttccaactgttaagggggtgaaaaggtct
agaattgttcatgattccgacgatgatagttga

DBGET integrated database retrieval system