KEGG   Gossypium raimondii: 105799868Help
Entry
105799868         CDS       T04129                                 

Definition
(RefSeq) short-chain dehydrogenase TIC 32, chloroplastic-like
  KO
K11153  retinol dehydrogenase 12 [EC:1.1.1.300]
Organism
gra  Gossypium raimondii
Pathway
gra01100  Metabolic pathways
Brite
Enzymes [BR:gra01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.300  NADP-retinol dehydrogenase
     105799868
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 KR Epimerase
Motif
Other DBs
NCBI-GeneID: 105799868
NCBI-ProteinID: XP_012486106
UniProt: A0A0D2NTU3
Position
6
AA seq 323 aa AA seqDB search
MDGVFRLVSGCPGPSGFGSASTAQEVTEGIDGTNLTALVTGGASGIGLETSRVLALRGVH
VIIGARNMKAANEAKNKIVRETPRARIDVLELDLCSTNSIRSFADNFIALHLPLNILINN
AGIMFCPFQLSQDGIEVQFATNHIGHFLLTNLLLDTMKNTVKASGIQGRVVNLSSIAHNY
CYKKGIRFHKINDKQGYSEKRAYGQSKLANILHANELSRRLQEEGVNITVNSVHPGLIMT
PLFRHSAALMKLLKFFSFFLWKNVPQGAATTCYVALHPRLNGVTGKYFADCNEMRPSSYA
RNESLARELWEFSNKLISSVSVP
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggatggggtgtttaggttggtgagtgggtgtccaggaccaagtggctttggttcagcc
tccaccgcccaagaggttaccgaagggattgatggaaccaacttgactgctctagttacc
ggaggagcaagtggaattgggttggaaacttctagagtattggctcttcgtggagtccac
gtcatcatcggtgcaaggaacatgaaagccgcgaatgaagcaaagaacaaaattgttaga
gagaccccaagagcccgtatagatgttctggagctggatctttgctctactaattcaatc
agatcatttgccgacaatttcatcgctcttcatcttcctctcaatatcttaataaacaat
gctggcatcatgttttgtccctttcagctttctcaagatggaatagaggtgcagtttgct
actaatcatataggacatttcctcttaacaaaccttctactggacacaatgaagaacaca
gttaaagcaagtgggatccaaggaagggttgtcaacttatcatcaatagctcacaactac
tgttataagaaagggatccgatttcataagatcaatgacaaacaaggatacagtgagaaa
agagcatatgggcagtccaaattagcaaatatattgcatgccaatgaactctctcgtcgg
ttgcaggaggagggtgtgaacatcacagttaattcggttcacccgggattgattatgacg
cctctgtttagacactccgctgctctaatgaaacttttgaaattcttcagtttctttctc
tggaagaacgttcctcagggggcagctacgacgtgctacgtcgcgctccacccgcgactc
aatggggtgaccggaaaatactttgcggactgcaatgagatgagaccaagttcatatgct
agaaatgagtccttggcaagggagctttgggaattcagtaacaaattgattagctcagtt
tcagtaccttaa

DBGET integrated database retrieval system