KEGG   Gossypium raimondii: 105799928Help
Entry
105799928         CDS       T04129                                 

Definition
(RefSeq) transcription factor DIVARICATA-like
Organism
gra  Gossypium raimondii
SSDB OrthologParalogGFIT
Motif
Pfam: Myb_DNA-binding Myb_DNA-bind_6 Myb_DNA-bind_7 tRNA_NucTransf2
Motif
Other DBs
NCBI-GeneID: 105799928
NCBI-ProteinID: XP_012486204
UniProt: A0A0D2NUG8
Position
6
AA seq 273 aa AA seqDB search
MMNRGFEILSPPSYSHASNWLFQESKDIKWTHQENKRFENALALYDQQTPDRWFNVAAMI
PGKTVADVIKQYRELEEDVSDIEAGLIPIPGYLTDSFTFNWVNNHTPGGKTGTGTPPCDQ
ERNKGVPWTEDEHRQFLMGLRKYGKGDWRSISRNFVTTRTPTQVASHAQKYFIRQLTGGK
DKRRPSIHDVTTLNIADTPSSSPDHGKPSSPKNASAVAGVTNEGAAIVFDQRSSGNALLS
PFCKVPSYGPKLDEQNLASGTLPTSQFGSYRGM
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacaggggatttgagattctctccccaccttcttattcacatgcttcgaattgg
ttgtttcaagagagcaaagatataaaatggactcaccaagagaacaagcgttttgaaaat
gctctggctttgtatgaccaacaaactcctgaccgatggtttaatgtggctgcaatgatt
ccagggaaaacagtggctgatgtaatcaaacagtacagagaattggaagaggatgttagt
gatatagaggcagggcttataccaattcctggatacctaactgattcttttacattcaat
tgggttaataaccataccccgggtggaaaaacagggactgggactccaccttgtgatcaa
gaaaggaataaaggtgttccatggactgaagatgaacacaggcaatttctaatgggtctt
agaaagtatggtaaaggggattggagaagtatatcgcgcaatttcgtgacgactagaacc
ccaactcaggtggcgagtcatgctcaaaagtacttcatcaggcagctcaccggagggaag
gacaagaggcggccgagcatccatgatgtcacaacacttaacatcgccgatacgccctct
tcttcaccagatcatggaaagccttcgtctcccaaaaatgcttctgcagtagccggggta
acaaatgaaggagcagccattgtttttgaccagaggagtagtggcaatgccttgctgtct
cctttctgtaaggttccttcatatggaccgaagctggatgaacaaaatttggcaagtgga
actctgcccacatctcaattcggatcttaccgtgggatgtga

DBGET integrated database retrieval system