KEGG   Gossypium raimondii: 105799966Help
Entry
105799966         CDS       T04129                                 

Definition
(RefSeq) pyruvate decarboxylase 2-like
  KO
K01568  pyruvate decarboxylase [EC:4.1.1.1]
Organism
gra  Gossypium raimondii
Pathway
gra00010  Glycolysis / Gluconeogenesis
gra01100  Metabolic pathways
gra01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gra00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    105799966
Enzymes [BR:gra01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.1  pyruvate decarboxylase
     105799966
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_M TPP_enzyme_C CO_dh
Motif
Other DBs
NCBI-GeneID: 105799966
NCBI-ProteinID: XP_012486247
UniProt: A0A0D2S5H4
Position
6
AA seq 605 aa AA seqDB search
MDTKIGSLDNCKPASNDVCSPVNGTVSTIQGSVYPAVVNFSEATLGRHLARRLVQIGVND
VFSVPGDFNLTLLDHLIAEPGLNLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSV
LNAIAGAYSESLPLICIVGGPNSNDYGTNRILHHTVGLPDFSQELRCFQTVTCYQAVVNN
LEDAHDMIDTAISTALKESKPVYISIGCNLAAIPHPTFAREPVPFALSPKLSNKMGLEAA
VEAAAEFLNKAVKPVLVGGPKLRVAKACEAFVELVDAGGYAVAVMPSGKGLVPEHHPHFI
GTYWGAVSTAFCAEIVESADAYLFAGPIYNDYSSVGYSLLLKKEKAIIVQPDRVVIGNGP
AFGCVLMKDFLRELAKRLKHNNTAYENYHRIFVPEGQPLKAAPKDPLRVNVLFQHIQKML
SSDSAVIAETGDSWFNCQKLKLPAGCGYEFQMQYGSIGWSVGATLGYAQAVPEKRVIACI
GDGSFQVTAQDVSTMLRCGQKTIIFLINNGGYTIEVEIHDGPYNVIKNWNYTALVDAIHN
GEGKCWTTKVFCEKELIEAIETATGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSR
PPNPQ
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atggataccaagattggatcacttgacaactgcaagcctgcttccaacgacgtttgctct
ccggtaaacggcaccgtttccaccattcaaggttccgtttaccccgccgttgtcaacttc
tctgaagccacactgggccgccacctggctaggcggcttgttcagatcggagtgaacgat
gttttctctgttcccggggatttcaacttgactttgcttgaccatttgattgccgagcct
gggcttaacctcatcggctgctgtaacgaactcaacgctgggtacgcggctgatggttat
gctcgatcacgtggcgttggtgcttgcgttgtcacattcaccgttggtgggctcagcgtt
ttgaatgccatcgccggtgcttacagtgagagtctccctcttatctgcattgtgggtgga
cccaactccaatgactatggaactaaccggattcttcaccacactgttggcttgcctgat
tttagtcaagagctcagatgtttccagactgttacttgctatcaggctgtggttaataac
ttggaggatgctcatgacatgatcgacacagctatttcaactgctttgaaagaaagcaag
cctgtttatatcagcatcggctgtaacttggccgcaattcctcatcctacttttgcccgc
gagcccgttccgtttgcactctctccaaaattaagtaataagatgggattagaggcagcg
gtggaggcagctgcagagttcttgaacaaggccgtgaaacccgttttagtcggtggacca
aagctacgtgttgccaaggcatgcgaggcttttgttgagttggttgatgctggtggctac
gccgtggcggtaatgccatcgggtaaagggcttgtccctgagcatcatcctcatttcatt
gggacgtactggggagctgttagtactgcattttgtgctgagatcgttgaatctgctgat
gcttacttattcgctggacctatttacaatgattatagctctgttgggtactctttgctt
cttaagaaagagaaggcgattattgtgcagcctgatcgggtggtcattggtaatgggcct
gcatttgggtgtgttttgatgaaagacttccttagagagcttgccaagaggcttaagcac
aataatactgcttatgagaattaccataggatttttgttcctgagggacaacctttgaag
gcagcacctaaagaccctttgagggtcaatgttttgttccaacatatacagaagatgctt
tctagtgactcagccgtgattgctgaaactggggattcttggtttaactgccagaagctg
aagttgcccgcaggatgtgggtatgaattccaaatgcagtatggatcaattgggtggtca
gttggtgccactcttggatatgcacaggctgttccggagaaacgtgtcatcgcttgcatt
ggtgatggtagttttcaggtgactgcacaagacgtgtccacaatgctgcgatgtgggcaa
aagaccataattttcctcataaataatggtgggtacaccattgaagtagagattcatgat
ggaccatacaatgtgatcaagaattggaactatactgccttggttgatgcaattcataat
ggtgaaggcaagtgctggacaaccaaggtattttgtgagaaagagctcattgaagcaatt
gagacggcaacaggagcgaagaaggactgcttatgcttcattgaagtgatcgttcacaag
gatgatactagcaaagagctgttggagtggggctccagggtttctgctgcgaatagccga
cccccaaatcctcagtaa

DBGET integrated database retrieval system