KEGG   Gossypium raimondii: 105800382Help
Entry
105800382         CDS       T04129                                 

Definition
(RefSeq) probable methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
gra  Gossypium raimondii
Pathway
gra00450  Selenocompound metabolism
gra00970  Aminoacyl-tRNA biosynthesis
gra01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gra00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    105800382
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    105800382
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:gra01007]
    105800382
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:gra03016]
    105800382
Enzymes [BR:gra01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     105800382
Amino acid related enzymes [BR:gra01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   105800382
Transfer RNA biogenesis [BR:gra03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    105800382
 Prokaryotic type
   Other AARSs
    105800382
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 Anticodon_1 Viral_protease tRNA-synt_1e
Motif
Other DBs
NCBI-GeneID: 105800382
NCBI-ProteinID: XP_012486940
UniProt: A0A0D2S806
Position
6
AA seq 800 aa AA seqDB search
MGDPNQMAPKLPVAGKRNVLITSALPYVNNVPHLGNIIGCVLSADVFARYCRLRGYNAIY
ICGTDEYGTTTETKAVEENCTPQEICDKYHALHKEVYDWFDISFDKFGRTSSPEQTEVCQ
AIFKKLWENNWLTEKPMQQLFCDTCQRFLADRLVEGTCPDGGCNYNSARGDQCEKCGKLL
NPTELKEPRCKACQNTPRIRDTRHLFLELPLLKDKLVEYINKMSVDGSWSQNAINTTQAW
LTEGLKARCITRDLKWGVPVPHENFKDKVFYVWFDAPIGYVSITKCYTSDWEKWWKNPEN
VELFQFMGKDNVPFHTVMFPSTLLGTRENWTLMKSISVTEYLNYEAGKFSKSKGIGVFGN
DVKDTKIPVEVWRYYLLTNRPEVSDTLFTWDDLQAKLNNELLSNLGNFINRVLSFIAKPP
GQGYGSIIPDSPTAESHPLTKALSEKVGKHVEQYIEAMEKVKLKQGLRTAMSLSGEGNAY
LQESQFWKLYKEDQPSCSIVMRTAVGLVHILACLLEPFIPSFSVEVFKQLNLPPQAQISL
CDEKGDIDKASRPWEIIPAGHKIGDPKPLFEELKTERVEELRQQYAGSQADRRARAEADA
AKTAEQLKKTKISDSKKEKAKKSSANSKEKPTAEPEISITRLDIRVGKIIKAQKHPDADS
LYVEEIDVGEAQPRTVVSGLVKYIPLEEMQDRMVCVLCNLKPATMRGIKSHAMVLAASNN
DHTKVELVEPPKSAKVGERVTFPGFTGEPDDVLNPKKKVWETLQVDLHSDANLVACYKDI
PLTTSAGICKVSSITNGSIR
NT seq 2403 nt NT seq  +upstreamnt  +downstreamnt
atgggagacccaaatcagatggctccgaagcttccagtcgctgggaaacgcaacgtcctc
atcaccagcgccttgccttacgtcaacaacgtccctcatctcggcaacatcatcggatgt
gtcttaagcgccgacgtttttgctcgctattgccggttgcgaggctataatgctatatat
atttgtggaaccgatgagtacggaacaacgacggagactaaagccgtggaagagaattgt
actcctcaagagatttgtgacaagtatcatgcacttcataaggaagtttatgattggttt
gatataagtttcgataagtttggaagaacatcgagtccggaacaaactgaagtttgccaa
gcaattttcaagaagctatgggagaacaattggcttacggagaaaccaatgcaacagctt
ttttgtgatacatgccaacgattcctggctgatcggcttgtggaaggaacctgtccagat
ggagggtgtaactacaattctgctcgtggagatcaatgtgaaaagtgcgggaagcttttg
aatcctactgaactaaaagaacctaggtgcaaggcctgccaaaatactccacgcattcgt
gacacaaggcacttatttcttgagcttcctttgctaaaggataaattagttgagtacatc
aacaaaatgtcagttgatggttcttggagccaaaatgctattaatacaacacaagcttgg
ctcacagaaggacttaaagctcggtgtattaccagagacttgaagtggggggttcctgtt
ccacacgagaattttaaggacaaggttttctatgtctggtttgatgcacctattggatat
gtctcaattactaaatgctacacatctgattgggaaaaatggtggaaaaatcctgaaaat
gtggagctgtttcagttcatgggaaaagacaatgtaccatttcatactgtgatgtttcca
tcaactcttcttgggacccgtgaaaactggacattgatgaaaagcatcagtgttacagag
tatttaaattacgaagctgggaagttctccaagagtaaaggcataggagtttttggcaat
gatgtaaaggatacaaaaatacctgtagaagtgtggagatattacttgttaaccaataga
cctgaggtttctgacaccttgtttacatgggacgacttgcaagcaaaactgaataatgag
ttgcttagtaatttgggcaacttcatcaatcgagtgttgagctttattgcaaaacctcct
ggtcaaggatatggttccattattcctgattctccaactgctgagtcacatcccttgaca
aaggctttaagtgagaaagttggtaaacatgtagagcaatatattgaagccatggagaag
gtgaaattaaagcaaggattaagaactgcaatgagcctctcaggtgaaggaaatgcatat
ctgcaagaaagccaattttggaagctttacaaagaagaccaaccttcttgttcaattgtt
atgagaactgcagtggggctagtgcatattcttgcatgcctattggaaccttttattcca
tctttttctgttgaggtatttaagcaacttaatttgcctcctcaagcacaaatttccctt
tgtgatgagaaaggagacatcgataaggcttcaagaccgtgggagataataccagctggg
cataaaattggagatccaaaacctttatttgaggaactgaaaactgaaagagttgaagag
ctaaggcaacaatatgccggaagtcaagctgataggcgtgcaagggcagaagccgatgct
gcaaagactgctgagcaactgaagaaaacaaaaatttcagatagcaagaaagagaaggct
aagaaatcttcagccaactctaaagaaaagcccactgctgaaccggaaatttccatcaca
agactcgatattcgggttggcaagattataaaagctcaaaagcatcccgatgctgattct
ctgtatgttgaagagatcgatgtgggtgaagcccagcctcgaacagttgttagtgggctc
gtgaaatatattcctttggaagagatgcaggaccggatggtttgtgttctttgtaatttg
aagcccgcaaccatgcgcggtataaaatcacatgcaatggttcttgcagcttcgaacaat
gaccacaccaaggtggaattggttgaaccaccaaagtcggccaaggtcggagagcgagtt
acctttcctggtttcacgggcgagcctgatgatgtgttaaacccaaagaaaaaggtttgg
gaaactctacaagtggatctccacagtgatgcaaatctggtggcctgttataaagatatt
cctttgaccacatctgctgggatttgcaaagtttcctccattaccaatgggtcaattaga
taa

DBGET integrated database retrieval system