KEGG   Gossypium raimondii: 105801283Help
Entry
105801283         CDS       T04129                                 

Definition
(RefSeq) probable terpene synthase 2
  KO
K15803  (-)-germacrene D synthase [EC:4.2.3.75]
Organism
gra  Gossypium raimondii
Pathway
gra00909  Sesquiterpenoid and triterpenoid biosynthesis
Brite
KEGG Orthology (KO) [BR:gra00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    105801283
Enzymes [BR:gra01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.75  (-)-germacrene D synthase
     105801283
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Terpene_synth_C ANTAR
Motif
Other DBs
NCBI-GeneID: 105801283
NCBI-ProteinID: XP_012488056
Position
7
AA seq 277 aa AA seqDB search
MMLLIKAFGSHKTQTCFYHSKQKCLISILDDIYDAYGKYEELEIFTKAIQRWDTNCIDQL
PDYMKLWYSETLNVYKDMEDLMSKDGKSYRVQVAIEAMKRQSQVYYVEAKWLHENYIPTM
EEYMPIALVSCGYWNLTVSSFVGMEDSITKETFNWAFNDPKIVRASCTICRLMSDIVGHK
VERERVHVSSAVECYMKQYGVSMQEAYDELYKQINNAWKDINEEFLKPTAAPTSALNRIL
HLARVIDLLYTGEDAYTQVGESAKTSITALLIDSIPI
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgatgctgctcataaaagcatttggatcacacaaaactcaaacttgcttttaccattct
aaacaaaaatgcctcatatcaattttggatgatatttatgatgcgtatggtaaatacgaa
gaacttgaaatctttacaaaagcaatccaaaggtgggataccaactgcattgatcaactt
ccggactacatgaaattgtggtatagtgaaaccttaaatgtttataaagatatggaagat
ttgatgtccaaagatggaaaatcatatcgcgtccaagtcgcaatagaagcaatgaaacga
caatctcaagtttactatgttgaggccaaatggttgcatgaaaattacataccaacaatg
gaggagtatatgccgattgcattagtctcttgtggttattggaatcttacggtgtcatct
tttgttggcatggaagatagcataacaaaagagacattcaattgggcatttaatgaccct
aagattgtcagagcttcatgcaccatttgtaggctgatgagtgatattgttggccacaag
gttgagagagagagagtacatgtgtcctcagcagtggagtgttacatgaaacaatatggg
gtgtcaatgcaagaggcctacgatgagttatacaagcaaataaacaatgcttggaaggat
ataaatgaagagttcttgaaaccaacagcagcaccaacatcggctcttaatcgaattcta
caccttgcaagggtcattgatctcctttacacgggcgaagatgcttatacgcaagttggg
gagtcagcaaaaactagcatcactgctttgctgatagattcaatcccaatttga

DBGET integrated database retrieval system