KEGG   Gossypium raimondii: 105802029Help
Entry
105802029         CDS       T04129                                 

Definition
(RefSeq) LRR receptor-like serine/threonine-protein kinase FEI 2
Organism
gra  Gossypium raimondii
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr LRRNT_2 LRR_8 LRR_4 Kinase-like Herpes_gE
Motif
Other DBs
NCBI-GeneID: 105802029
NCBI-ProteinID: XP_012488883
UniProt: A0A0D2QKU8
Position
7
AA seq 601 aa AA seqDB search
MSVFVWFSSVIFAVTLWNSGSFALTDDGLTLLEIKSTLHDSKNFLGNWLATDESPCNWTG
ISCFPNLQRVRSINLPYMQLGGSISPSIGKLNRLQRLALHQNNLHGLIPNEISNCTHLRA
LYLRANYLEGGIPSNIGSLSLLTVLDLSSNLLKGSIPLSIGRLTRLRYLNLSTNFFSGEI
PDIGVLNTFGNKSFIGNLDLCGQQVQRPCRTSLGFPAVLPHAESDEAAGQTKRSSHYIKG
VLIGAMSTMAVMLVVLLAFLWICLLSKKERAAKRYTEVKKQVHEDSSKKLITFHGDLPYP
SCEIIEKLESLDEEDVVGSGGFGTVYRMVMNDCGTFAVKRIDRNHEGSDQAFERELEILG
SIKHINLVNLRGYCRLPASKLLIYDYLAMGSLDNFLHESKEDVRPLNWCARLKIALGSAR
GIAYLHHDCCPKIVHLDIKSSNILLDENLEPHVSDFGLAKLLVDEETHVTTVVAGTFGYL
APEYLQSGRATEKSDIYSFGVLLLELLTGKRPTDPTFVKRGLNVVGWMNTLLRENRLEYI
VDRRCNDTDMETLEAILEVAAKCTDANPDERPTMSQVVQLLEQEVMSPCPSDFYDSHSDY
C
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtgtttgtgtggttttcctctgtgatttttgctgttaccctttggaactctggt
tcttttgctctcactgacgacggtttaacattgctggagatcaaaagcacactgcatgac
agtaaaaactttcttggaaactggcttgctactgatgaatcaccctgtaattggactggc
atttcatgttttcccaatcttcaaagagttcgatcaatcaacctaccctacatgcaatta
ggagggtcaatctctcccagcattggcaaactcaacagattgcaaagattggcactgcac
caaaacaatttacatggactaattcctaatgaaatttcaaattgtactcatttgagagct
ctttacttgagagctaattatcttgaaggaggcataccatcaaatattggaagcctttct
cttctcactgtactggatttatcgagcaatttgctgaagggttctatacctttgtctata
ggccgtcttacaagattgcgttaccttaatttgtccaccaactttttctccggtgaaatc
ccagatatcggagtacttaacacttttgggaacaagtcgtttatcggcaatttggattta
tgtggacaacaagttcaacggccatgtcggacttcactcggattcccagcagttctacct
catgctgaaagtgatgaagcagctggccaaacaaagcgatcatctcattacataaaaggt
gtgctgatcggtgcaatgtcaacaatggctgtcatgcttgttgtgctccttgcatttctt
tggatatgtcttctatcgaagaaggaaagggctgctaagagatacacagaagtcaaaaaa
caagtccacgaagattcgagcaaaaaacttatcacatttcatggggatttgccgtatcca
tcatgcgagattatagaaaagctggagtcccttgatgaagaagatgttgtggggtcgggt
ggatttggaactgtatatcgaatggtcatgaatgattgtggaacatttgctgttaaaaga
atagatcggaaccatgaaggatctgatcaagccttcgagagagagttagagatcttgggc
agcatcaaacacattaatttagtcaacctacgaggttactgcaggttgccggcatcaaaa
ctgcttatctatgattatcttgctatgggcagcttggacaactttcttcatgaaagcaaa
gaagatgtcaggccattgaattggtgtgctcgattaaaaatagcccttggttctgcccga
ggtattgcatacttgcaccatgattgttgtccgaagatagttcatctagacataaaatcc
agcaatattcttctcgatgaaaacttggagcctcatgtatccgacttcggtcttgccaaa
cttttggtggatgaggagacacacgtcactactgtcgttgctggcactttcggctatttg
gctccagaatatctgcaaagcggtcgagccactgaaaagtctgacatctatagctttgga
gttctcttgttggagcttttaaccggaaaaaggccaaccgatccaacttttgtgaagagg
ggcttgaatgttgttggttggatgaacacactattgagagagaaccgattagaatacata
gttgatcgaaggtgtaatgacactgacatggaaactttagaagcaattcttgaagtagca
gcaaaatgtaccgatgcaaatccagacgaacgaccaacaatgagccaggtagttcagttg
cttgaacaagaggtcatgtcaccttgccctagtgatttttacgactctcactcggattac
tgttaa

DBGET integrated database retrieval system