KEGG   Gossypium raimondii: 105803427Help
Entry
105803427         CDS       T04129                                 

Definition
(RefSeq) probable serine/threonine-protein kinase WNK11
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
gra  Gossypium raimondii
Brite
KEGG Orthology (KO) [BR:gra00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gra01001]
    105803427
   01009 Protein phosphatases and associated proteins [BR:gra01009]
    105803427
Enzymes [BR:gra01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     105803427
Protein kinases [BR:gra01001]
 Serine/threonine kinases: Other
  Wnk family
   105803427
Protein phosphatases and associated proteins [BR:gra01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     105803427
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal APH
Motif
Other DBs
NCBI-GeneID: 105803427
NCBI-ProteinID: XP_012491066
UniProt: A0A0D2SLF3
Position
7
AA seq 298 aa AA seqDB search
MMPAASTNMSDREGESFVEVDPTGRFGRYNDLLGAGAVKKVYRAFDQEEGIEVAWNQVKL
TNFSEDPVLINRLQSEVQLLRTLKNKYIIVCYSVWRDREHNTLNFITEVCTSGNLRSYRK
KHRHVSIKALKKWSKQVLEGLEYLHTHDPCIIHRDLNCSNIFINGNIGQVKIGDLGLAAI
VGRSHCAHSIIGTPEYMAPELYEEDYTEMVDIYSFGMCLLEMVTMEIPYSECDSVAKIYK
KVTSGVRPRALNTVPDPEVKAFIEKCIAQPRARPSASELLKDPFFSDLKDDEIDSVST
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgatgccggctgctagcaccaatatgtctgaccgagagggagaatcatttgttgaggtt
gatcccactggtcgctttgggcgctataatgatttgcttggtgccggtgcagtgaagaag
gtttacagggcatttgatcaggaggaaggtatagaggtggcctggaatcaagtgaaattg
accaacttcagtgaagaccctgtgcttatcaataggcttcaatccgaggtacagttgctg
agaacgttgaaaaacaagtatatcattgtttgctacagtgtctggagggatcgagaacat
aacacattaaattttatcactgaggtctgcacatcgggaaacttgagatcttacaggaaa
aagcatcgccacgtgtccattaaggccttgaagaagtggtcaaagcaggtacttgaagga
ttggaatatctccatacacatgacccttgcattattcacagagatctaaattgcagcaac
atcttcatcaatgggaacattggccaagtgaaaattggcgacctgggacttgcggcaata
gttgggagaagccattgtgcacattccataatagggacaccggaatatatggcaccggag
ctttacgaggaagattacacagagatggtggatatatactcgtttggaatgtgcttgctt
gagatggtgacaatggagataccttatagcgaatgtgacagtgttgccaaaatatacaag
aaggtcacctctggcgtgagaccccgagccttgaacacagtcccagatccagaagtgaag
gcatttatcgagaaatgcatagcccagccaagggcaagaccttcagcttctgaacttctc
aaggaccccttcttttctgacctcaaagatgatgagatagactcagtgtccacttga

DBGET integrated database retrieval system