KEGG   Gramella sp. SH35: C7S20_00575Help
Entry
C7S20_00575       CDS       T05367                                 

Definition
(GenBank) haloacid dehalogenase
  KO
K20866  glucose-1-phosphatase [EC:3.1.3.10]
Organism
grs  Gramella sp. SH35
Pathway
grs00010  Glycolysis / Gluconeogenesis
grs01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:grs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    C7S20_00575
Enzymes [BR:grs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     C7S20_00575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like PyocinActivator
Motif
Other DBs
NCBI-ProteinID: AVR43887
UniProt: A0A2R3Z0U3
Position
122056..122664
Genome map
AA seq 202 aa AA seqDB search
MIDAIIFDFGDVFINLDKEATTRKLKEMDIDKLPDSITAMNRDYEQGFVTSDEIAEKYRA
QFPQLEKENFMQSWNAMILEFPEYRFRFIQKLAEEKDFKLILLSNTNENHIEYIKSNVSF
FNDFKQCFDGFYLSHEIGLRKPDPEIFEFLVDKHDLKPENTLFIDDTKENTETAARLGFN
VWNIEPTREDVIDLFTTKKELF
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgattgacgcgatcatatttgactttggagatgtatttataaatcttgataaagaggcg
accacccgaaaactaaaggaaatggatatcgacaaattgcccgattccatcaccgccatg
aaccgcgattatgaacagggatttgttacttccgatgagatcgctgaaaaataccgtgca
caattcccgcagctggaaaaagaaaatttcatgcagtcgtggaacgccatgatcctggaa
tttccggaatatcgctttcgctttattcagaaactggccgaagagaaagattttaagctt
atcctgcttagtaataccaacgaaaatcacatcgaatacatcaaaagcaacgtttccttt
tttaatgattttaaacaatgctttgacggattttacctctcgcacgaaataggacttcga
aaacccgacccggaaatttttgaatttctggttgacaaacatgatctgaaaccggaaaat
actttatttatagacgataccaaagaaaatactgaaaccgcagccaggctgggcttcaat
gtatggaatatcgaaccaacgcgagaggatgtgatcgatcttttcactactaaaaaggaa
ttattttga

DBGET integrated database retrieval system