KEGG   Gramella sp. SH35: C7S20_04610Help
Entry
C7S20_04610       CDS       T05367                                 

Definition
(GenBank) N-acylglucosamine 2-epimerase
  KO
K16213  cellobiose epimerase [EC:5.1.3.11]
Organism
grs  Gramella sp. SH35
Brite
KEGG Orthology (KO) [BR:grs00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    C7S20_04610
Enzymes [BR:grs01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.11  cellobiose epimerase
     C7S20_04610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GlcNAc_2-epim Glyco_hydro_88 DUF1724 LANC_like
Motif
Other DBs
NCBI-ProteinID: AVR47326
UniProt: A0A2R3ZAN0
Position
1000437..1001639
Genome map
AA seq 400 aa AA seqDB search
MAEKTQAYKTSLEQELREILHFWEENAIDEEFGGFMGKRDFFNKKVEKAPKGIILNTRLL
WSFSAAGNHYKNDRYKELATRAYRYLRENFRDTKNGGVFWELDHTGKPINTRKQIYAQAF
AIYALSEYYEYCKEAQALEWAEELFQLIEEKALDPDQNGYYEAFQHDWSPIKDMRLSEKD
DNSSKTMNTHLHILEAYGNLFRVKGGEKEKKALENLVDLFLNRFLYDNIWHFQLFFDDNW
KRANNLISYGHDIEAVWLILEAARAVKNEQLIQKAASTTIEVARTFLKEAYIKNAGVINE
KDLDSGKTDTDRHWWPQVEAMLGLEYAFELTGEDIFRKAERDIWKYTLKHIKDRKHGEWH
FRVDENNHPYTSEDKVSMWKAPYHTSRALIKLLKNHTYEK
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atcgctgaaaaaactcaagcctataagaccagcctggagcaggaactccgggaaattctc
catttctgggaagaaaatgctattgatgaagaatttggaggttttatgggaaaaagagat
tttttcaataaaaaagtagagaaagcccctaaagggatcattctgaatacccgtttgctg
tggtctttttctgctgccggcaatcattataagaatgaccgttataaagaattagccacc
agggcctatcgctatctcagggaaaatttcagagatacgaaaaatggcggggtcttctgg
gaactcgatcatacaggaaagcctattaatacccgcaagcaaatctatgcccaggccttt
gctatctatgccttgtcggaatattacgaatactgcaaagaagcgcaggctttggaatgg
gctgaagaactttttcagttaattgaagaaaaagcgctcgatcccgatcaaaatggatac
tacgaagctttccagcacgactggtcgccaatcaaagatatgcgcctgagcgaaaaggat
gataattcttcaaaaaccatgaatacccatcttcatatcctggaagcttacggcaatcta
ttccgggtaaaaggaggtgaaaaagaaaaaaaagcgcttgaaaatctggtcgatttattt
ctgaaccgatttttatatgataatatctggcattttcagcttttctttgatgataactgg
aaaagggccaataaccttatttcctacggtcatgatattgaggccgtgtggctgatcctc
gaagcggccagggcagtgaagaatgaacaactcatccaaaaggctgcatctactactata
gaagtggccagaacttttctgaaagaagcctacattaaaaatgcgggcgtcatcaatgaa
aaggatcttgacagcggtaagacggataccgaccgtcactggtggccgcaggttgaagcc
atgcttgggctggaatacgcgtttgagcttaccggggaagatattttccggaaggctgag
cgcgatatttggaaatataccctaaaacatataaaagacagaaagcacggggaatggcat
ttcagagtcgatgaaaataaccatccctataccagcgaagataaagtaagcatgtggaag
gcgccctaccatacctcccgggctttgataaaactgttaaaaaaccatacctatgaaaaa
tag

DBGET integrated database retrieval system