KEGG   Gramella sp. SH35: C7S20_09525Help
Entry
C7S20_09525       CDS       T05367                                 

Definition
(GenBank) siroheme synthase
  KO
K02304  precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:1.3.1.76 4.99.1.4]
Organism
grs  Gramella sp. SH35
Pathway
grs00860  Porphyrin and chlorophyll metabolism
grs01100  Metabolic pathways
grs01110  Biosynthesis of secondary metabolites
grs01120  Microbial metabolism in diverse environments
Module
grs_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:grs00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    C7S20_09525
Enzymes [BR:grs01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     C7S20_09525
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     C7S20_09525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_7 Sirohm_synth_M Shikimate_DH Sedlin_N GFO_IDH_MocA Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: AVR45489
UniProt: A0A2R3Z5G4
Position
2087455..2088048
Genome map
AA seq 197 aa AA seqDB search
MEERNELYPVFLKVSKLNILVVGGGNVGHEKLHFLLKSSPNANVEVVAKWFLSETEALAK
AHGVKLTKGRYRKKYLKKRHIVIAATNDAKLNKRVHRDAKKRYLLANIADTPELCDFYMG
GIVNKGHVKIAISTNGKSPTTAKRLRQFFEEVIPENVNEMVENLNEYRKTIKGDFEAKVT
ELNNITETLIGKKEKDD
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaagaaacgagctatacccggtttttctgaaagtcagcaaactgaacatcctc
gtagttggcggcggaaatgtaggccatgaaaagttgcattttctgctgaaatccagtccg
aatgcgaatgttgaggtggtggcgaaatggtttctgtccgagaccgaagccctcgcgaaa
gcacatggggtgaagctcaccaaaggaaggtatagaaagaagtatttgaagaaaaggcat
attgtgattgcggctaccaatgatgcaaaattaaataagcgggtgcatcgcgatgctaaa
aagcgctacctgctggccaatatcgccgatacccctgaactctgtgatttttatatgggt
ggaattgtaaataaaggccatgtgaaaatagccatttcgactaatgggaaatccccgaca
actgcgaagcgattgcgccagttcttcgaggaggtaattcccgaaaacgtaaacgaaatg
gtagaaaatttgaacgaataccgaaaaacgataaaaggcgatttcgaagccaaagtaact
gaattgaataatataacagaaaccttaattggaaaaaaagagaaagatgattaa

DBGET integrated database retrieval system