KEGG   Gramella sp. SH35: C7S20_17050Help
Entry
C7S20_17050       CDS       T05367                                 

Definition
(GenBank) molybdopterin converting factor
  KO
K03635  molybdopterin synthase catalytic subunit [EC:2.8.1.12]
Organism
grs  Gramella sp. SH35
Pathway
grs00790  Folate biosynthesis
grs01100  Metabolic pathways
grs04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:grs00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    C7S20_17050
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    C7S20_17050
Enzymes [BR:grs01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.12  molybdopterin synthase
     C7S20_17050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MoaE
Motif
Other DBs
NCBI-ProteinID: AVR46827
UniProt: A0A2R3Z998
Position
complement(3792544..3792987)
Genome map
AA seq 147 aa AA seqDB search
MNKKKPKKVFVQGAIPPEKIANSIGNHQSKTNIGAHSIFLGQIRADEIDGKTVSAIDYSA
YEEMAENVFHEIREATFSKFDITCAHIYHSLGKVKTGEICLFVFTSSAHRKIAIEACNYF
VEEIKANVPIFGKEIFEDETHQWKVNK
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgaataagaaaaaaccaaaaaaagtattcgttcagggtgcgattccgccggaaaagatc
gcgaattccattgggaatcatcaatctaaaacaaatattggtgcgcacagcatttttctg
ggtcagattcgagccgatgagattgatggcaaaacagtaagcgcgatagactattcggct
tatgaagaaatggccgaaaatgtattccatgagatcagggaagctaccttttcgaaattt
gatattacctgcgcccatatttatcatagccttggcaaagtgaaaaccggggaaatttgt
cttttcgtgttcacctcttcggcgcatagaaaaatagccatagaggcctgcaattatttt
gtagaggaaattaaggcgaatgtaccaattttcggaaaagagattttcgaggatgaaact
catcaatggaaagtgaataaatag

DBGET integrated database retrieval system