KEGG   Gordonia rubripertincta: GCWB2_03630Help
Entry
GCWB2_03630       CDS       T05629                                 

Definition
(GenBank) 2-oxoglutaramate amidase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
gru  Gordonia rubripertincta
Brite
KEGG Orthology (KO) [BR:gru00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    GCWB2_03630
Enzymes [BR:gru01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     GCWB2_03630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase Lipase_GDSL_2
Motif
Other DBs
NCBI-ProteinID: ASR01553
UniProt: A0A222TF99
Position
779208..780074
Genome map
AA seq 288 aa AA seqDB search
MAQISSTDDPGENLETLRAATRDAASRGARLVVFPEATMCRFGVPLKPVAEDLGGPWASA
VSEVARSAGVTVVAGMFTPSDDGRVFNTVLVAHPDGSRQGYDKLHLYDAFGFRESKTVAA
GSEPLTFEVDGVTVGVATCYDIRFPALFTNLARRGAQIVVVPTSWGAGPGKIHQWQVLAT
ARALDSTTFVVAVGQALPPDETVAGSGAPTGIGHSQITDPFGTVVAAYPETVGVDVHDLD
LELVEKARKQLAVLANERELTAGGAVPSKVASTAERLRESDDRGRNHP
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atggctcagatcagctcgaccgacgatccgggcgagaacctggagaccctccgtgcggcg
acgcgggatgcggcatcgcgcggggcgcgcctggtcgtgttcccggaggcgaccatgtgc
cggttcggcgttccgttgaagccggtcgcggaggatctcggcgggccgtgggcgagtgcg
gtgtcggaggtcgcgaggtcggcgggtgtgaccgtcgtggccgggatgttcaccccgtcg
gacgacgggcgcgtgttcaacacggtgctcgtcgcacacccggacgggtcgcggcaggga
tacgacaagctgcatctgtacgacgccttcgggttccgcgaatccaagaccgtcgcggcc
ggttcggaaccgctgaccttcgaggtcgatggcgtcaccgtgggggtggccacctgctac
gacatcaggttccccgccctgttcaccaatctggcccgacgcggtgcgcagatcgtcgtc
gtaccgacgtcgtggggcgccggccccggcaagatccatcagtggcaggtgctcgcgacg
gccagagcgctggattcgacgacgttcgtcgtcgccgtggggcaggcacttcccccggac
gagacggtcgccgggtcgggtgcgccgaccgggatcggacacagccaaatcacagacccc
ttcggtaccgtggtcgccgcgtacccggagacggtcggtgtcgatgtccacgacctcgac
ctggaactggtcgagaaggctcgtaaacaactggcggtcctcgccaacgagcgagagctg
actgccggcggtgcggtgcccagcaaggtcgcatccaccgccgaacggcttcgagagtcc
gacgaccgaggacggaatcatccatga

DBGET integrated database retrieval system