KEGG   Gordonia rubripertincta: GCWB2_15650Help
Entry
GCWB2_15650       CDS       T05629                                 

Gene name
murD
Definition
(GenBank) UDP-N-acetylmuramoylalanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
gru  Gordonia rubripertincta
Pathway
gru00471  D-Glutamine and D-glutamate metabolism
gru00550  Peptidoglycan biosynthesis
gru01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gru00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    GCWB2_15650 (murD)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    GCWB2_15650 (murD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:gru01011]
    GCWB2_15650 (murD)
Enzymes [BR:gru01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     GCWB2_15650 (murD)
Peptidoglycan biosynthesis and degradation proteins [BR:gru01011]
 Precursor biosynthesis
  Amino acid ligase
   GCWB2_15650 (murD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C Thi4 NAD_binding_8 FAD_binding_3 Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: ASR03917
UniProt: A0A222TLT0
Position
complement(3428225..3429811)
Genome map
AA seq 528 aa AA seqDB search
MADPRAENPASDGDPLGLAGKTVVIGGAGTAGMSAARYLVTRGVRILLADDRFAAGDAGA
ADRESAVAAVPGVADLIAQGAAAVAISDLLVDPSWTADTAVVIVSPGFAPTHDLVAQAAA
GGVPVWGEVELAWRVDAAGLLGEPRTWLVVTGTNGKTTTTSMLADIIERSGRAGAACGNI
GLPVLDAMRATPRVDVLCAELSSFQLHWAPSVAPAAGVVLNVADDHLDWHGTFDAYALAK
AGALRGDIAVVGLDDAVASGLPGAGRRVGFTLNPPQDGQLGVEDGQLVDRAFGAGRLLSA
DAVHPAGPSGVADALAAAALALSIGVERDAVETALTDFRPAAHRGEVVATRDGIRFVDDS
KATNPHAAQAAVAAYDRVVLIAGGLLKGASMDGMLTAVGDRLAGVVAIGRDRDLVVEAIA
RHAPEVPTVTVFTGDDGTVNVHRQGQTAPVLSSIPNSSTRASGSDTAVAVMDRAVAEAWE
LAAASDPKPDAVLLAPAAASLDMFAGYGRRGDAFAHAAQDIAGTSAAR
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atggctgatccgcgcgccgagaaccccgcgtcggacggcgacccgctggggttggccggg
aagaccgtggtgatcggcggcgcgggtaccgccggcatgtccgcggcccgctacctggtc
accaggggcgtccgcatcctcctcgccgacgaccggttcgccgcaggtgatgccggcgcc
gccgaccgggagtcggccgtcgccgctgtccccggggtcgccgacctgatcgcccagggc
gccgccgccgtcgcgatctccgatctgctcgtcgacccctcgtggaccgccgacaccgcg
gtcgtgatcgtctcgcccggattcgcacccacccacgatctcgtcgcgcaggctgcggcg
ggcggtgtgccggtgtggggcgaggtcgagctggcctggcgggtcgacgccgcgggtctg
ctcggggagccgcggacctggctggtcgtcaccggcaccaacggcaagaccaccaccacc
tcgatgctcgccgacatcatcgagcgctccgggcgtgccggcgcggcgtgcggcaacatc
ggcctgccggtcctcgatgccatgcgtgcgacgccccgcgtcgacgtgctgtgcgccgag
ttgtcgtccttccagctgcactgggcgccgtcggtcgccccggccgcgggggtggtactc
aacgtcgccgacgaccatctcgactggcacggcaccttcgacgcctatgcactggccaag
gccggtgcgctgcgcggcgacatcgcggtcgtcggtctcgacgacgccgtcgcgtcgggc
ttgccgggcgcggggcgccgggtcggcttcacgctcaacccgccgcaggacggccagctc
ggcgtcgaggacgggcagctcgtcgaccgtgccttcggcgcgggtcgtctgctgtcggcg
gacgccgtgcatccggccggcccgtcgggcgtcgccgacgccctcgccgccgccgcactc
gccctctcgatcggtgtcgaacgcgacgccgtcgagaccgcgctcaccgatttccggccc
gccgcccatcgtggcgaggtcgtggcgacacgcgacggcatccgcttcgtcgacgactcc
aaggccaccaacccgcatgccgcccaggctgcggtcgccgcgtacgaccgcgtggtgctg
atcgcgggcggcctgctcaaaggcgcgtcgatggacgggatgctcaccgcggtcggcgat
cggctcgccggggtggtcgccatcggccgggatcgtgatctggtcgtcgaagcgatcgcg
cgacacgccccagaagtcccaacagtcacagtattcacaggggacgatggcacggtgaac
gtgcatcgccagggtcagaccgcacccgtcctctcgtcgatcccgaactcgtcgactcga
gcctcggggtcggacaccgccgttgccgtgatggaccgggcggtcgccgaggcctgggag
ctcgccgcggcgagcgacccgaagcccgacgcggtgctcctcgcacccgccgcggcgtcg
ctggacatgttcgccggctacggccggcgcggtgacgcgttcgcgcacgccgcacaggac
atcgccggcacctccgccgcgcggtga

DBGET integrated database retrieval system