KEGG   Gordonia rubripertincta: GCWB2_22720Help
Entry
GCWB2_22720       CDS       T05629                                 

Gene name
hdhA
Definition
(GenBank) 7-alpha-hydroxysteroid dehydrogenase
  KO
K00076  7-alpha-hydroxysteroid dehydrogenase [EC:1.1.1.159]
Organism
gru  Gordonia rubripertincta
Pathway
gru00121  Secondary bile acid biosynthesis
Brite
KEGG Orthology (KO) [BR:gru00001]
 09100 Metabolism
  09103 Lipid metabolism
   00121 Secondary bile acid biosynthesis
    GCWB2_22720 (hdhA)
Enzymes [BR:gru01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.159  7alpha-hydroxysteroid dehydrogenase
     GCWB2_22720 (hdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR 3HCDH_N Epimerase
Motif
Other DBs
NCBI-ProteinID: ASR05315
UniProt: A0A222TRN6
Position
complement(4972876..4973667)
Genome map
AA seq 263 aa AA seqDB search
MILDRFRIDDHVAVVTGAGRGLGAAIAVAFAQAGADVVIAARSEFDLDQVAGQIADAGRR
ARVVPVDLSNADATAALAQTAVEEFGRLDTIVNNVGGAMPRPLLDTTPQHLVDAFDFNVA
NAHALVVAGAKQMLATTGHGSIINITSAVGRVPGRAYAAYGTAKAALAHYTRIAAMDLNP
KIRVNGIAPGAILTSSLEIVAGNDEMRTALENATPMHRLGDPEDIAAAALYLASPAGAYV
TGKILEVDGGIIAPNLDLPIPDL
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
gtgattctcgacagattccgtatcgatgaccatgtcgccgtcgtcaccggtgccggtcgc
ggcctgggtgcggccatcgccgtggccttcgcccaggcgggtgccgacgtggtgatcgcg
gcgcgcagcgaattcgacctcgaccaggtagccggacagatcgccgacgccgggcgtcgc
gcccgcgtcgtcccggtcgatctcagcaacgccgacgccacggccgcgctcgcccagacc
gcggtcgaggagttcggacggctggacacgatcgtcaacaacgtgggcggcgcgatgccg
cgcccgctcctcgacaccaccccccaacacctcgtcgatgccttcgacttcaacgtcgcc
aacgcgcacgcgctcgtcgtggccggcgccaagcagatgctcgcgacgaccggtcacggt
tcgatcatcaacatcacctcggccgtcggccgggtgccgggtcgcgcgtatgccgcctat
ggaaccgcgaaagccgctctggcgcactacacccggatcgccgcgatggacctgaacccg
aagatccgggtcaacgggatcgcgcccggggcgatcctcacatcgtcactcgagatcgtg
gccggcaacgacgagatgcggaccgcactcgagaacgccaccccgatgcaccggctcggc
gaccccgaggacatcgctgccgcggccctgtacctggcctcaccggcgggtgcctacgtc
accggcaagatcctcgaggtcgacggcggaatcatcgcaccgaacctggacctgccgatc
ccggatctgtag

DBGET integrated database retrieval system