KEGG   Gryllotalpicola sp. 2DFW10M-5: D7I44_02675Help
Entry
D7I44_02675       CDS       T05660                                 

Definition
(GenBank) PHP domain-containing protein
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
gry  Gryllotalpicola sp. 2DFW10M-5
Brite
KEGG Orthology (KO) [BR:gry00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    D7I44_02675
Enzymes [BR:gry01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     D7I44_02675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP
Motif
Other DBs
NCBI-ProteinID: AYG05230
UniProt: A0A387BVS0
Position
complement(534003..534860)
Genome map
AA seq 285 aa AA seqDB search
MPQKSWRAPIDLHTHSSVSDGTQTPAELVRAAAEAGLGTVALTDHDSTAGWADASAEASA
LDLGFVPGMELSTRFGWKSVHMLAYFFDPENAALVAETERIRDARRTRAEAMVARIAADY
DLTWEDVLAHTTPGASVGRPHIADALVTRGLVTDRSAAFETLLHPRGGYFEPLYAPTPLE
GVELIRGAGGAPVLAHPATRGRDTVLDARYLASLVEAGLAGVEVRHRENTEDGKAYLLEF
ARVHDLVVTGSSDYHGAGKPNLLGENTTSPEALERLFRAASGASS
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
ctgccccagaaaagctggcgtgctccgatcgacctgcacacgcactcgagcgtgtccgac
ggcacgcagacgcccgccgagctcgtgcgggcggcggccgaggcagggctcggaacggtc
gcgctgaccgaccacgattcgacggccgggtgggcggatgcctcggccgaggcatccgca
ctcgatctcggcttcgtgcccggcatggagctgtcaacccggttcgggtggaagagcgtg
cacatgctcgcgtacttcttcgaccccgagaacgcggcgctcgtcgccgagaccgagcgc
atccgcgacgcgcggcgcacccgggctgaggcgatggtcgcgcgcatcgctgcggactac
gacctcacgtgggaggacgtgctcgcgcacacgacccccggggcatccgttggccgcccc
cacatcgccgacgcgctcgtgacgcgcgggctcgtgaccgaccgcagcgcggcgttcgag
acgctgctgcacccgcgcggcgggtacttcgagccgctgtacgcgccgacgccgctcgag
ggcgtcgagttgatccgcggcgcagggggagcgcctgtgctcgcgcatcccgcgacccgt
gggcgcgacaccgtgctggacgcccggtacctcgcctcgctcgtcgaggccgggctcgcc
ggagtcgaggtgcgccaccgcgagaacacggaggacggcaaggcgtacctgctcgagttc
gcgcgcgtccacgacctcgtcgtcaccggatcgagcgactaccacggcgctgggaaaccc
aatctgctcggcgagaacacgacctcgccggaggcgctcgagcggctgttccgcgcggcg
tccggtgcctcttcgtag

DBGET integrated database retrieval system