KEGG   Gryllotalpicola sp. 2DFW10M-5: D7I44_06445Help
Entry
D7I44_06445       CDS       T05660                                 

Definition
(GenBank) beta-glucosidase
  KO
K05349  beta-glucosidase [EC:3.2.1.21]
Organism
gry  Gryllotalpicola sp. 2DFW10M-5
Pathway
gry00460  Cyanoamino acid metabolism
gry00500  Starch and sucrose metabolism
gry01100  Metabolic pathways
gry01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gry00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    D7I44_06445
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    D7I44_06445
Enzymes [BR:gry01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     D7I44_06445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3_C Glyco_hydro_3 Fn3-like Lipase_GDSL_2
Motif
Other DBs
NCBI-ProteinID: AYG03204
UniProt: A0A387BME7
Position
complement(1310469..1313054)
Genome map
AA seq 861 aa AA seqDB search
MPSLEEKVRLLTGETSFTTYAVESLGVEPMALSDGPIGIRGVADPPPVAAQLPNPTAVAA
TWDLELTARLGTLIGHEAKRLGIDVVLAPIVNIQRTPVGGRHFETYSEDPALTVDTMVAF
VKAVQAEGVGVCVKHFVGNESETERTEYLARIPEQALREVYLAPFEAAVKKAGAWSIMAA
YNRVEAGGEIAQATDHGYLINDVLKGEWGFDGVVVSDWLATKTTIESALGGLDLVMPGPG
GPWEQKLLAAVATGDVPESVIDDKVVRLLRLAKRVGKLHDPAAEEPRSLKSAEGASRAEP
REGDGLETSQASNARPAEAAALLREAVARASVVLRNESELLPLDPAEVSRIALIGPNAVE
PFVQGGGSAFVNAPYLVTPEAGLREAFPDAEVTVHRGVASRRFAHVIDPELVTTADGTPG
YTLELLDADGGAVGEPQVIAASEGWNRGIVAGAQAARVTARVTLGEPGAHRVEVGLVGIH
TAWFDGELVSESGDFADSNVILNSSANHPAGPSAVFEVAEGETRVVEISVECQVVDAGAY
SRFVRFELRHDSEVAPANSVATTANSRVRPAGTGEQTSTDDVDLEAAIAAASAADVAVVI
IGTNEEVESEGWDRQSLALPGRQDELVRRVAAANPRTVVVVNAGAPVILPWLDEVPATLW
WWLPGQEAGNGLADALTGATEPSGRLPWTLPAAEADVPVPHALPVDGVVEYTEGVHVGYR
GWERLGRVPARPFGFGLGYSVWKLGVPIAAEEWGADDALPVTVALTNDGERDARGVVQFY
LSGPRDGDGDGGWDRPARWLVGHAAQEVLAGRVVAVTLRIPRRAFQVWSVAAQQWITPSG
VYTIRAASDARDPGQTVTITL
NT seq 2586 nt NT seq  +upstreamnt  +downstreamnt
gtgccgtcgctcgaagagaaggtccgcctgctgaccggtgagacctcattcaccacctat
gcggtcgaaagcctcggcgtcgagccgatggcgctcagtgacggccccatcggcatccgt
ggcgtcgccgacccgccgccggtcgccgcgcagctgcccaacccgaccgcggtcgcggcg
acgtgggatctcgagctcaccgcgcgcctcggcacgttgatcgggcacgaggcgaagcgc
ctcggcatcgacgtggtgctcgcgccgatcgtgaacatccagcggacgccggtcggcggc
cgtcacttcgagacctacagcgaagaccccgcgttgaccgtcgacacgatggtcgcgttc
gtgaaggcagtgcaggccgagggcgtcggcgtgtgcgtcaagcacttcgtcggcaacgag
tcggagaccgagcgcaccgaatacctggcgcggattcccgaacaggctctgcgcgaggtg
tacctcgccccgtttgaggccgcggtcaaaaaggcgggcgcgtggtcgatcatggccgcc
tacaaccgcgtcgaggcaggcggcgagatcgcgcaggccaccgatcacggatacctgatc
aacgacgtgctcaagggcgagtggggcttcgacggcgtcgtcgtctcagactggctcgcg
acgaagaccacgatcgagtcggccctcggcgggctcgacctcgtgatgcctggccccggc
ggcccgtgggagcagaagctgctcgccgccgtcgctacgggcgacgtgccggagtcagtc
atcgacgacaaggtcgtgcgcctgctgagactggcgaagcgcgtcggcaagctccacgat
cccgccgcagaagagccccgctcgctgaagagcgcagaaggcgcgtctcgagccgagccg
cgtgagggcgatggtctcgagacgtcccaggcgtcgaacgctcgaccagcggaggcggcg
gcgctgctgcgggaagccgtcgcgcgagcatccgtcgtgctgcgcaatgagagcgagctg
ctgccgctcgacccggcagaggtctcgagaatcgcgctgatcggaccgaacgccgtcgag
ccgttcgtgcagggcggcggcagcgcgttcgtcaacgcgccgtacctcgtcactcccgag
gcaggcctgcgcgaggcgttccccgacgccgaggtgacggtccaccgcggcgtggcatcg
cgccgcttcgcgcacgtgatcgacccggagctcgtgacgacggccgatggcacgccgggc
tataccctcgagctcctcgacgccgacggcggcgcggtcggcgagccccaggtgatcgcc
gcgagcgagggctggaaccgcggcatcgtcgcgggcgcgcaggcggcgcgcgtgaccgct
cgcgtgacgctcggcgagccgggtgcgcatcgggtcgaggtgggtctggtcggcatccac
acggcgtggttcgacggcgagctcgtcagcgaatccggcgatttcgccgactccaacgtg
atcctgaactcgtcggccaaccaccccgccggcccgagcgccgtgttcgaggtggcagag
ggcgagacccgggtcgtcgagatctcggtcgaatgccaggtggtggatgccggtgcgtac
agccgcttcgtgcggttcgaactgcggcacgactccgaggtggcgccagcgaattcggtg
gccacgacggcgaattcgcgggttcgcccagcggggacgggcgaacagacaagcaccgac
gatgtcgacctcgaggcggccatcgccgcggcatccgccgccgacgtcgcggtcgtgatc
atcggcaccaatgaagaggtcgagtcagagggctgggaccggcagagcctcgcgctgccc
ggccggcaggacgagctcgtgcgccgcgtcgccgccgcgaacccccgcacggtcgtggtc
gtgaacgcgggcgctcccgtgatcctgccgtggctcgacgaggtgcccgcgacgctgtgg
tggtggctgcccgggcaggaggccggcaacggcctcgccgacgcgctcaccggtgcgacc
gagccgagcgggcgcctgccctggacgctgcccgcagccgaggcggacgtcccggtcccg
cacgctctgccggtcgacggggtcgtcgagtacacagagggcgtgcacgtcggctatcgc
ggctgggagcggctcggccgggtgcccgcgcgtcccttcgggttcggcctcggctattcg
gtgtggaagctcggcgttccgatcgccgcagaggagtggggcgcggacgacgccctgccc
gtcaccgtcgcgctgaccaacgacggcgagcgtgatgcgcgtggcgtcgtgcagttctat
ctgtcgggtccgagggatggcgacggcgatggcggctgggaccgaccagcccggtggctg
gtgggccacgccgcgcaggaggtgctcgcgggccgggtcgtggccgtcacgctgcgcatc
ccgcgccgtgccttccaggtgtggagcgtcgccgctcagcagtggatcacgccgtcgggc
gtctacacgatccgcgcggcgtccgacgcccgcgacccgggccagacggtgacgatcacg
ctgtaa

DBGET integrated database retrieval system