KEGG   Gryllotalpicola sp. 2DFW10M-5: D7I44_07385Help
Entry
D7I44_07385       CDS       T05660                                 

Definition
(GenBank) fuconate dehydratase
  KO
K18334  L-fuconate dehydratase [EC:4.2.1.68]
Organism
gry  Gryllotalpicola sp. 2DFW10M-5
Pathway
gry00051  Fructose and mannose metabolism
gry01100  Metabolic pathways
gry01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gry00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    D7I44_07385
Enzymes [BR:gry01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.68  L-fuconate dehydratase
     D7I44_07385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MR_MLE_C MR_MLE_N
Motif
Other DBs
NCBI-ProteinID: AYG05314
UniProt: A0A387BTB2
Position
complement(1516880..1518085)
Genome map
AA seq 401 aa AA seqDB search
MNPDPDYSAAYVRIGTDAGDSGHAFVFTIGRGNDVEVAAIKALAPYVLGQSAEELLADLG
GVWRRLQHDSQLRWLGPEKGVMHMAIGAVVNALWDLRAKRAGKPLWRLLAELSPEELVDL
VDFRYLSDALTRDDALELLRRAEPGRAERIARLEAEGYPAYTTTPGWLGYTDEKLARLSR
EAVAEGFPQIKLKVGASLDDDRRRLAIAREAVGPGIRIAVDANQRWDVDEAIEWMRALAP
FDIAWIEEPTNPDDVLGHAAIARAISPIPVATGEHGANRVMFKQFLQAGALQVLQIDYTR
VSGVNENLANLLLAAKFGVPVCPHAGGVGLCEAVQHLAMFDFVALSGTFDDRMIEFVDHL
HEHFVTPVDVHDGRYWPPAAPGAGTEMHAASIAEYEFPADV
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgaaccccgaccccgactactccgcggcgtacgtgcgcatcggcacggacgccggcgac
agcggtcacgcgttcgtcttcacgatcgggcgcggcaacgacgtcgaggtcgcggcgatc
aaagccctcgccccctacgtgctcgggcagagcgcagaagagctgctcgccgacctcggc
ggcgtctggcgccgactgcagcacgactcgcagctgcgctggctcgggccggagaagggc
gttatgcacatggcgatcggcgcggtcgtgaacgccctgtgggacctgcgcgcgaagcgg
gcgggcaagccgctgtggcgactgctcgccgagctgagcccggaggagctcgtcgacctc
gtcgacttccggtacctgagcgacgcgctcacccgcgacgacgcgctcgaactgctgcgt
cgcgcagagcccggccgcgccgagcgcatcgcccgcctcgaggccgagggctacccggcc
tacacgaccacccccggctggctcggctacaccgacgagaagctcgcgcggctcagccgc
gaggccgtcgccgaggggttcccgcagatcaagctcaaggtcggggcgagcctcgacgac
gaccggcggcgactcgccatcgcgcgcgaggcggtcggcccaggcatccgtatcgccgtc
gatgccaaccagcgctgggacgtcgacgaagcgatcgagtggatgcgcgcgctcgcaccc
ttcgacatcgcctggatcgaggagccgacgaaccccgacgacgtgctcgggcacgcggcc
atcgcgcgcgccatctcgccgattccggtcgcgaccggcgagcacggcgcgaaccgcgtg
atgttcaagcagttccttcaggcaggcgcgctgcaggtgctgcagatcgactacacgcgg
gtctcgggcgtgaacgagaacctcgcgaatctgctgctggccgcgaagttcggggtgccg
gtgtgcccgcacgcgggcggcgtcggtctgtgcgaggcggtgcagcacctcgcgatgttc
gacttcgtggcgctctcgggcacattcgacgaccgcatgatcgagttcgtcgaccacctg
cacgagcacttcgtcacgccggtcgatgtgcacgacgggcggtactggccacccgctgcg
ccgggggccggcacagagatgcatgccgcctcgatcgccgagtatgagttccctgcggat
gtctga

DBGET integrated database retrieval system