KEGG   Gryllotalpicola sp. 2DFW10M-5: D7I44_07505Help
Entry
D7I44_07505       CDS       T05660                                 

Definition
(GenBank) anion permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
gry  Gryllotalpicola sp. 2DFW10M-5
Brite
KEGG Orthology (KO) [BR:gry00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    D7I44_07505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AYG03392
UniProt: A0A387BLZ3
Position
complement(1546416..1547615)
Genome map
AA seq 399 aa AA seqDB search
MSLTLIVVLVVALALFFDFTNGFHDTANAMATPIATGALRPRPAVALAAALNLVGAFLST
EVAQTISGGLIRGEGGQVSITPALVLAGLVGAITWNLITWLWGIPSSSSHALFGGLIGAT
IVGTWDVGSIDYSVLLAKIVIPALLSPVVAGLVAYSATRLAYAITHRGDGLADGRSGFRY
AQIFSSSLVALSHGTNDAQKTMGVITLLLIAAGIQPASHAGPQWWVIVACGLAIATGTYT
GGWRIIRTLGRGLTEVKPAQGFAAETSTAATILASSHFGFALSTTQVASGSVIGSGLGRS
DGHVRWGTAGRIALGWLLTLPVAAVVGGATAMIARLGTIGLIIDLAIAVVVIVVVFRINA
RRRVTAEHMAAGTEAEVASATSAIHITRPVPVAPGEEKR
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
gtgagcctgaccctgatcgtcgttctggtggtcgcgctggcactgttcttcgatttcacg
aacggattccacgacaccgccaacgccatggcgacgccgatcgcgacgggtgcgctgagg
ccgcggccggcggtcgcgctcgcggccgcgctgaacctcgtcggcgcgttcctctcgacc
gaggtggcgcagacgatctcgggcgggctgatccgcggcgagggcggccaggtctcgatc
accccggcgctcgtgcttgcggggctggtcggtgcgatcacctggaacctgatcacctgg
ctgtggggaatcccctcgtcatccagccatgcgctgttcggaggcctcatcggcgcgacc
atcgtcggcacgtgggacgtcgggtcgatcgactactcggtgctgctcgcgaagatcgtg
atccccgcactgctctcgccggtggtcgcagggctggtcgcctactccgcgacgcgcctc
gcctacgccatcacgcaccgcggcgatgggctcgccgacgggcgcagcggcttccgctac
gcacagatcttctcgtcgtcgctggtcgcgctgtcgcatggcaccaacgacgcgcagaag
acgatgggcgtgatcacgctgctgctcatcgcagccggcatacagcccgcgtcgcacgcc
ggcccgcagtggtgggtgatcgtcgcctgcggcctcgcgatcgcgaccggcacctatacg
ggcgggtggcggatcatccgcaccctcggccgcggcctcaccgaggtgaagcccgctcag
ggcttcgcggcggagacgagcacggcggcgacgatcctcgcctcttcgcacttcggcttc
gcgctctcgaccacgcaggtcgcgtcgggctcggtgatcggctcgggactcggccgcagc
gacggccacgtgcgctggggcacggcgggccgcatcgcgctcggctggctgctgacgctg
cccgtggccgccgtggtcggcggcgcgaccgccatgatcgcccgcctcggcacgatcggc
ctcatcatcgacctcgccatcgcggtcgtcgtgatcgtcgtggtcttccgcatcaacgcg
cgccgccgtgtcaccgccgagcacatggcggcgggcaccgaggccgaggtcgcgtccgcc
acctccgccatccacatcacgaggccggtcccggtcgcgcccggcgaggagaagcggtga

DBGET integrated database retrieval system