KEGG   Gryllotalpicola sp. 2DFW10M-5: D7I44_11875Help
Entry
D7I44_11875       CDS       T05660                                 

Gene name
mqo
Definition
(GenBank) malate dehydrogenase (quinone)
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
gry  Gryllotalpicola sp. 2DFW10M-5
Pathway
gry00020  Citrate cycle (TCA cycle)
gry00620  Pyruvate metabolism
gry01100  Metabolic pathways
gry01110  Biosynthesis of secondary metabolites
gry01120  Microbial metabolism in diverse environments
gry01130  Biosynthesis of antibiotics
gry01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gry00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    D7I44_11875 (mqo)
   00620 Pyruvate metabolism
    D7I44_11875 (mqo)
Enzymes [BR:gry01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     D7I44_11875 (mqo)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AYG04157
UniProt: A0A387BT88
Position
2431137..2432603
Genome map
AA seq 488 aa AA seqDB search
MSDKPPVDVVLIGGGIMSATLGTFLKRVRPDWSIVILERLGAVAEESSNPWNNAGTGHSA
LCELNYMPHPDDPTKALQINEQFQQSRQFWAQLVEEGVLGQASDFINPAPHMTFVRKPSD
IEYLRMRHETLTKHVLFEELEYSEDRDVVKTWAPLLMRGRNRYEQFAATRSIAGTDVNFG
TLTKRLIDNLVAGGAELKLNSEVRGVKKRGGLWRVKVRQLVEQRTSTIDAKFVFVGAGGW
ALKVLQASGIPEAKGFGTFPISGQFYKTTNPEVVGQHAVKVYSQAEAGAPPMSVPHLDKR
VVDGQASLLFGPYAGADPKFLKYGSVLDLPAGLRASNIGPYLNVAKDNLVLLRYLISQLL
LTRKGKFAELRKFMPTAQPGDWELITAGQRAQVIKKDAKKGGVLQFGTEVIAHEDGTIVG
LLGASPGASTAVSIMLDVLAKCFPSEYAGEWQSELKTLIPTLGQQLDTDPELARATMQRT
AGVLGLPK
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgacaaaccccccgttgatgtggtcttgattggcggcggcatcatgtccgccacc
ctcggaaccttcctcaagcgggtgaggcccgactggtcgatcgtgatcctcgagcgcctc
ggggcggtcgccgaagagagctcgaacccgtggaacaacgcgggcacgggccacagcgcg
ctgtgcgagctcaactacatgccccacccggacgacccgacgaaggccttgcagatcaac
gagcagttccagcagagccgccagttctgggcgcagctcgtggaagagggggtgctgggg
caggcatccgacttcatcaatcccgcgccgcacatgacgttcgtgcgcaagccgagcgat
atcgagtatctgcgcatgcggcacgagacgctgacgaagcacgtgctgttcgaagagctc
gagtacagcgaggaccgcgacgtggtcaagacctgggcgccgctgttgatgcgcgggcgc
aacaggtacgagcagttcgcggcgacgcggtcgatcgcgggcaccgatgtgaacttcggc
actctcaccaagcggctcatcgacaacctcgtcgcggggggcgccgagctgaagctgaac
tcagaggtgcgcggcgtgaagaagcgcggcggactgtggcgagtcaaggtgcggcagctc
gtcgagcagcgcacgagcacgatcgacgcgaagttcgtcttcgtcggggcgggcggctgg
gcgctcaaggtgctgcaggcctcggggattccggaggcgaagggcttcggcaccttcccg
atctccggccagttctacaagacgacgaaccccgaggtcgtcggtcagcacgctgtgaag
gtgtactcgcaggccgaggcgggcgcgccgccgatgagcgtgccgcacctcgacaagcgc
gtggtcgacgggcaggcgtcgctgctgttcgggccgtacgcgggcgccgaccccaagttc
ctcaagtacggcagcgtgctcgacctgcccgcgggcctgcgggcgtcgaacatcgggccg
tacctcaacgtcgccaaagacaacctggtcttgctgcgctacctgatcagccagctgctg
ctcacccgcaagggcaagttcgccgagctgcgcaagttcatgccgacggcgcagccgggg
gactgggagctgatcaccgcgggtcagcgcgcgcaggtgatcaagaaggatgccaagaag
ggcggcgtgctgcagttcggcaccgaggtgatcgcgcatgaggacggcacgatcgtcggc
ctgctcggcgcctcgccgggggcctcgacggcggtgtcgatcatgctcgacgtgctcgcg
aagtgcttcccgagcgagtatgcgggggagtggcagagcgagctcaagacgctgatcccg
acgctcggccagcagctcgacaccgaccccgagctcgcgcgcgccacgatgcagcgcacg
gcaggcgtgctggggctgcccaagtag

DBGET integrated database retrieval system