KEGG   Geoalkalibacter subterraneus: GSUB_00840Help
Entry
GSUB_00840        CDS       T03585                                 

Definition
(GenBank) seryl-tRNA synthetase
  KO
K01875  seryl-tRNA synthetase [EC:6.1.1.11]
Organism
gsb  Geoalkalibacter subterraneus
Pathway
gsb00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:gsb00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    GSUB_00840
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:gsb01007]
    GSUB_00840
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:gsb03016]
    GSUB_00840
Enzymes [BR:gsb01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.11  serine---tRNA ligase
     GSUB_00840
Amino acid related enzymes [BR:gsb01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   GSUB_00840
Transfer RNA biogenesis [BR:gsb03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    GSUB_00840
 Prokaryotic type
    GSUB_00840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2b Seryl_tRNA_N MukF_M DUF2203 BST2
Motif
Other DBs
NCBI-ProteinID: AJF05423
UniProt: A0A0B5FDP1
Position
177640..178911
Genome map
AA seq 423 aa AA seqDB search
MLDLKYLRENLDDVEQKLRTRGESLTLAPFRELDQKRRTLLQESESLKAERNQVSALIGR
TKDKSQVQGEITRMKEVSGRIKELDAELKGAEEQLQQWLLQVPNIPHEKTPVGDSEEDNP
VVRQWGEPTQFDFEPRAHWDLGEQLGILDFERAVKLSGARFSLSLGAGARLERALINFML
DLHTQEHKYVEVLPPFMVNRDSMTGTGQLPKFESDLFHTEDVDLFLIPTAEVPVTNIYRD
EILAADRLPISFTAYTPCFRKEAGSHGRDVRGLIRQHQFNKVELVKFVRPQDSDAELENL
LGHAEEVLKRLELPYRVVDLCTGDIGFSAARTFDIEVWLPGQQAYREISSCSNFRDFQAR
RARIRYRPEEGAKPEYVHTLNGSGLAVGRTLVAILENYQQQDGSVTVPAALRPYMGGLER
ITA
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgctcgatcttaaatatctgcgggaaaatctcgacgacgttgaacagaaactgcgcacc
cggggcgaatcgctgacgctggcgccgttccgtgagctggaccagaagcggcgcaccctg
ctgcaggagagcgagtcgctcaaggccgagcgcaaccaggtttccgccctcatcggccgc
accaaggacaaaagccaggtgcagggcgaaatcacccgcatgaaagaggtctccggacgc
atcaaggaactcgatgccgaactcaagggcgccgaggagcagctgcagcagtggctgctg
caggttcccaatatcccccacgaaaagacgcctgttggagattccgaagaagacaatccc
gtggtgcggcagtggggcgagccgacacagttcgattttgaacccagggcccactgggat
ctgggtgagcagctcggcattctcgactttgaacgggcggtgaaactctccggggcgcgc
ttttctctgtcgctcggtgccggtgcgcgcctcgagcgtgcgctgatcaacttcatgctc
gacctgcacacgcaagagcataaatatgttgaagtattgccgccctttatggtaaacaga
gactccatgacggggaccggacagctccccaagttcgagagtgatcttttccatactgaa
gacgttgatctgttcctgattcctacggcggaagtgccggtcaccaatatttaccgcgac
gagattcttgccgccgaccggctgccgatcagcttcaccgcctacaccccctgcttccgc
aaagaggccgggtcgcacgggcgggacgtgcgcggcctgatccgccagcatcagttcaac
aaggtcgaattggtgaaattcgttcggccgcaggactccgacgccgaactcgagaatctg
ctcggccacgccgaggaggtgctcaagcggctcgaactgccctaccgggtggtggacctg
tgcaccggcgacatcggcttttccgctgctcgcactttcgatatcgaagtgtggctgccc
gggcagcaggcttatcgggagatctcctcctgctccaacttccgggatttccaggcgcgc
cgcgcccgcatccgctaccgccccgaagaaggggccaagcccgaatacgtgcatacgctt
aacggttcggggctggcggtcgggcgcacgctggtggcgattctcgagaattaccagcag
caggatggttccgtgacggtccccgcggctttgcgcccctacatgggcggcctggagcga
atcaccgcataa

DBGET integrated database retrieval system