KEGG   Geoalkalibacter subterraneus: GSUB_07135Help
Entry
GSUB_07135        CDS       T03585                                 

Definition
(GenBank) glutamyl-tRNA synthetase
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
gsb  Geoalkalibacter subterraneus
Pathway
gsb00860  Porphyrin and chlorophyll metabolism
gsb00970  Aminoacyl-tRNA biosynthesis
gsb01100  Metabolic pathways
gsb01110  Biosynthesis of secondary metabolites
gsb01120  Microbial metabolism in diverse environments
Module
gsb_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:gsb00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    GSUB_07135
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    GSUB_07135
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:gsb01007]
    GSUB_07135
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:gsb03016]
    GSUB_07135
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:gsb02048]
    GSUB_07135
Enzymes [BR:gsb01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     GSUB_07135
Amino acid related enzymes [BR:gsb01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   GSUB_07135
Transfer RNA biogenesis [BR:gsb03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    GSUB_07135
 Prokaryotic type
   Other AARSs
    GSUB_07135
Prokaryotic defense system [BR:gsb02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    GSUB_07135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1c
Motif
Other DBs
NCBI-ProteinID: AJF06366
UniProt: A0A0B5FS04
Position
1554716..1556116
Genome map
AA seq 466 aa AA seqDB search
MSDLRVRFAPSPTGYLHIGGARTALFNYLLARKEKGTFVLRIEDTDVARSTQESTDAILN
AMEWLGLSYDEGPYYQSERFDLYREKVEELLEKGLAYRCYCTPEELEEKRKKAQEEGRKP
KYDGTCRERADQPEDQPYVVRFRSPQQGAVTFVDRIKGAITFSNDELDDLIIQRTDGTPT
YNFVVVIDDATMGINLIIRGDDHINNTPRQILLYQALGYDVPTFAHVPMILGEDKTRLSK
RHGATSVMAYREMGYLPEALVNYLVRLGWSHGDQEIFSMQELIEKFSLEHVGKAAGVFNP
GKLLWLNEHYIKTGDPARLGELLRPFLEAKGLSPEGGPALPEVVTTLRDRAKTLVEMADG
AAFYYKKELEFDGKAVAKFLTEDKVPVFKSLIAGLEKASDWNHDSIEAVFNKVMKDYELK
LGKVAQPVRVALTGGTTSPSIFEVIQVLGRETTLRRLKEVFPLCGA
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacctgcgagtccgtttcgcgcccagcccgaccgggtatctccatatcggcggc
gcacgaaccgcactgttcaactacctgctggcacggaaggaaaaaggcacctttgtcctg
cgcatcgaggataccgacgtggcgcggtccacccaggaatccaccgatgccatcctcaat
gccatggaatggcttggactcagctacgatgaagggccgtattaccagtcggaacgtttc
gacctctaccgtgaaaaagtcgaagagcttctcgaaaagggactggcttaccgctgctac
tgtactccggaggagttggaggagaagcgtaaaaaggcccaggaggaggggcgcaagccc
aagtacgacggcacctgccgcgagcgggcagatcagccggaggatcagccgtatgtcgtg
cgctttcgctctccccagcaaggcgcggtgacgtttgtcgatcgcatcaaaggggcgatc
accttcagcaacgatgagctcgatgatctcattattcagcgcaccgacgggacgccgacc
tataatttcgtggttgtcattgacgatgcgaccatggggatcaacctgattattcgcggc
gacgatcacatcaacaatacaccgcgccagattctgctttaccaggcgctgggctacgac
gtgccgacattcgcccatgtcccgatgatcctcggcgaggacaaaacacgtctatccaag
cgtcacggcgccacgtcggtaatggcttacagggagatgggctatctgcccgaggccctg
gtcaattacctggtgcgcctggggtggtcccatggcgatcaggaaattttttccatgcag
gagctgatcgagaagttttccctggagcatgtcggcaaggcggcaggagtcttcaacccc
ggcaagctgttgtggctcaatgagcattacatcaagaccggcgatccggcgcgtctggga
gagttgctgcgtccgtttcttgaagccaaggggctcagccctgaaggcggacccgctctg
ccggaggttgtgaccaccctgcgcgaccgcgcaaagacgttggtggaaatggccgatggg
gccgccttctattacaaaaaagagcttgaattcgatggcaaggccgtcgccaagtttctt
acggaggacaaagttcccgtctttaagagcctcattgcaggtttggagaaagcctccgac
tggaaccacgacagcatcgaggcggttttcaacaaggtgatgaaagattatgagctcaag
ctggggaaagtggctcaaccggtccgtgttgcgttgaccggaggcacgaccagcccgagc
atttttgaagtcatccaggtccttgggcgggaaaccactttgcgtcgactgaaagaggtt
tttcctctttgcggggcgtaa

DBGET integrated database retrieval system