KEGG   Geoalkalibacter subterraneus: GSUB_07500Help
Entry
GSUB_07500        CDS       T03585                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
gsb  Geoalkalibacter subterraneus
Pathway
gsb00450  Selenocompound metabolism
gsb00970  Aminoacyl-tRNA biosynthesis
gsb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gsb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    GSUB_07500
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    GSUB_07500
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:gsb01007]
    GSUB_07500
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:gsb03016]
    GSUB_07500
Enzymes [BR:gsb01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     GSUB_07500
Amino acid related enzymes [BR:gsb01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   GSUB_07500
Transfer RNA biogenesis [BR:gsb03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    GSUB_07500
 Prokaryotic type
   Other AARSs
    GSUB_07500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1
Motif
Other DBs
NCBI-ProteinID: AJF06419
UniProt: A0A0B5FP33
Position
complement(1640894..1642426)
Genome map
AA seq 510 aa AA seqDB search
MPQPFYITTPIYYVNDVPHIGHAYTTLACDVMARYKRARGHEVFFLTGTDEHGQKVEKAA
QAKGETPNELADRVVKRFQALWERLNISHTDFIRTTQERHKKGVHKLFEIIESKGDIYLG
EYVDWYCTPCETFWTETQLMDGSCPDCGRPTEKLKEESYFFRMSKYQDALLKHIEENPDF
IQPKSRRNEILSFVREGLRDLSISRTTFSWGLPVPGNDKHVIYVWFDALSNYITALGYPD
DPDGNFSKFWPVDVHMIGKDILRFHTVYWPTFLLAAGIPLPKRVFAHGWWTVEGQKMSKS
LMNVVEPNMLVDKYGVDAIRYFLMREVPFGLDGDFSHQALTNRINSDLANDLGNLVSRTT
AMINKYFNGELPPPAAADDMDSEFVARFPNSLLTLDRHMDDLAFHKALQTIWELISAANR
YIDQTAPWVLAKDPADRERLATVMYNLAEASRIIGLMISPFMPDTSEKILDILGCDPNDP
KLRGRDIWGGLNAGTKIEKAAPLFPRIERE
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgccgcagccattttacatcacaactcccatttattacgtcaacgacgttcctcacatc
ggtcacgcctacaccaccctggcctgcgacgtgatggcccgctataagagggcccgcgga
cacgaggtattcttcctcaccggaaccgacgaacacggccagaaggtcgaaaaggcggct
caagccaagggagaaacacccaacgagcttgccgaccgggtcgtgaaacgctttcaggcc
ctgtgggagcggctcaacatctcgcacaccgatttcatccgaaccacccaggagcgccac
aaaaagggggttcacaagctctttgaaatcatcgaatccaagggggacatctatctcggc
gagtatgtagattggtactgcactccctgtgaaacattctggaccgaaacccagttgatg
gacggcagctgccccgattgcggccgtccgacggaaaagctcaaggaagaatcctatttc
ttccgcatgagcaagtaccaggatgctctgctcaagcatatcgaggaaaaccccgacttc
atccagcccaagtcacgccgcaacgagatcctgagctttgtccgcgagggactgcgcgat
ctgtccatctctcgcaccacattttcctggggacttccggttcccggcaacgacaaacat
gtgatttacgtgtggttcgacgccctttccaattacatcaccgcgctgggctaccctgat
gatcccgacggaaacttcagcaagttctggccggtcgatgttcatatgatcggcaaggac
atcctgcgttttcacaccgtttactggcccaccttcctactggccgcaggcatccccctg
ccgaaaagagtttttgctcacggctggtggacagtcgaagggcagaaaatgagtaaaagc
ctgatgaatgttgtggaaccgaacatgctggtggacaaatacggcgtggacgccatccgc
tactttctcatgcgcgaagtgccgttcggccttgacggtgatttctcccaccaggcgttg
accaaccgcatcaattcggatctggccaacgacctgggcaacctggtgagccggaccacc
gccatgatcaacaaatatttcaacggggaactgccgccgccggccgcggcagacgatatg
gacagcgaattcgtcgcgcgcttccccaacagcctgctaacgcttgatcgccacatggac
gatctggcctttcacaaggctctgcagaccatctgggagctgatcagcgccgccaaccgc
tacatcgatcagacggcaccctgggttctagccaaagatccggccgaccgcgaacgcctc
gcaacggtcatgtacaacctggcggaggccagccgcatcattgggctgatgatttcccct
ttcatgccggacacttccgagaagattctcgacatcctcggctgcgacccgaacgatccg
aagctgcgcggacgcgatatctggggcggtttgaacgccggaacgaaaatcgaaaaagca
gcgcccctgtttccgcgtatagagcgggagtag

DBGET integrated database retrieval system