KEGG   Geoalkalibacter subterraneus: GSUB_07765Help
Entry
GSUB_07765        CDS       T03585                                 

Definition
(GenBank) phenylalanyl-tRNA synthetase subunit beta
  KO
K01890  phenylalanyl-tRNA synthetase beta chain [EC:6.1.1.20]
Organism
gsb  Geoalkalibacter subterraneus
Pathway
gsb00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:gsb00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    GSUB_07765
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:gsb01007]
    GSUB_07765
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:gsb03016]
    GSUB_07765
Enzymes [BR:gsb01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.20  phenylalanine---tRNA ligase
     GSUB_07765
Amino acid related enzymes [BR:gsb01007]
 Aminoacyl-tRNA synthetase
  Class II (U)
   GSUB_07765
Transfer RNA biogenesis [BR:gsb03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    GSUB_07765
 Prokaryotic type
    GSUB_07765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA_synthFbeta B3_4 FDX-ACB tRNA_bind B5
Motif
Other DBs
NCBI-ProteinID: AJF06461
UniProt: A0A0B5FS85
Position
1690792..1693212
Genome map
AA seq 806 aa AA seqDB search
MIVTYNWLKEFVDCDLAPDELSHRLTMAGLEVDAMDVLGEGLDTVVVARLLSVESHPDAD
RLTLCQVDAGGGDPVQVVCGATNHKTGDLVAFAQVGTVLPGDFKIKKSKIRGQVSFGMLC
SEKELGLAEEAEGIMILPADLPLGKPVFDALGLKDVRFELGLTPNRADCLSVVGVAREVA
AICGKPMRLPQVSVKEEGEPIAERTSVTIEEPGMCPRYAARLIRDVRIGSSPAWLVRRLE
SVGQRSINNVVDVTNYVLMELGHPLHAFDFRLLRGGRIVVRRAGDNQKFTTLDGQERILN
SGDLTICDADGPVALAGIMGGENSEIQPDTVDILLESAYFNPPTIRRTSKRLGIHSESSH
RFERGADVDMVPIALDRAAELIRETAGGAISQGALDVYPAPIAEKSLRIHTDKTQRLLGV
RIDTLEIKRLLETIGFSCHLEDGAPEGIVHVNVPNCRPDIEREVDLIEEVARLNGYDQIP
TTMPAGRVVCHPDSPLRRIEQALRNAMVACGFSEVINYSFNAPAALDRIALPEQDERRSQ
VRLLNPLTEEQSVMRTTLVPSVLQNVAQNLARRSAGDLRLFELRPVFLPDGGDDLPREVP
HLVFALSGRRSPLGWAQSSEPVDFFDLKGVVEELMEQLRLDSVEYSPDQGESFLHPGKSC
ALTCNQVVLGLLGEVHPQVLKEFEIEQPVYICDLDLSAIADVAGNPVVFKELSRFPGVDR
DSALLVDEEIEARRILDAALNARARDVEDVVLFDVYRGKGIPQGKKSIAIRVRYRRADKT
LTDEEVAKSHSRIIKALENELGAEIR
NT seq 2421 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtcacctataactggcttaaagagtttgtagattgtgaccttgcgcctgatgag
ctctcccatcgtctgaccatggccggtcttgaagtcgatgcgatggacgtactcggggaa
ggtctcgatactgttgtcgttgcccgcctgctcagcgtggaatcacatcccgatgccgac
cgtctgaccctgtgtcaggtcgatgccggcggtggtgatccggttcaggttgtgtgtggt
gcgaccaaccacaagacgggcgacctggttgcgtttgcgcaggttgggactgtcctgccc
ggtgatttcaagatcaagaaatccaagatccgcggacaggtctccttcggcatgctctgc
tcggaaaaggaactcggtctggccgaagaggccgagggcattatgatccttcctgccgat
ctgcctttgggaaagcctgtttttgacgccctggggctcaaggacgtgcgcttcgagctg
gggttgaccccaaaccgggcggactgcctcagtgttgtcggcgtggcgcgtgaggtcgct
gccatctgcggcaaacccatgcggctgccgcaggtgagcgtgaaggaggaaggggagccc
atagcagagcgcacctcggtgaccatcgaggagcctggcatgtgcccgcgttacgcagcc
cgcctgattcgcgacgttcgcataggttcctctcccgcgtggctcgttcgccgtctggag
tccgtcggacagcgctccatcaacaacgttgtcgatgtgaccaactatgttctgatggag
ttggggcatcctctgcatgctttcgacttccgtctcctgcgcggcgggcgcatcgttgtg
cgcagagcaggcgacaatcaaaaattcaccactctcgacggccaggagcgcatcctcaat
tcgggagatctgaccatctgtgatgccgatgggccggtcgcgcttgccggcatcatgggt
ggggaaaattcagagattcaaccagatacggtcgatattctgctggaaagtgcctatttc
aatccgcccaccatccggcgcaccagcaagcgccttggaattcacagcgagtcgtcccac
cgtttcgagcgcggcgccgatgtggatatggtgcccattgccctcgaccgggcggccgaa
ttgattcgcgaaacggcaggcggcgcaatctcccagggagcgctcgacgtttatcctgcg
cccatcgctgaaaagagcttgcgcattcacactgacaagacccagcggctgctgggtgtg
cgtatcgacactcttgaaatcaaacgcctgcttgaaacaatcggcttttcctgccatctt
gaagacggcgcaccggaaggaatcgttcacgtcaatgtgccgaactgccggccggacatt
gaacgggaagtcgacctgattgaagaggttgcgcgtcttaacggctatgatcagattccc
accaccatgccggccggtcgggtcgtatgccatcctgattcgccgcttcggcgcatcgag
caggccctgcgcaacgccatggtggcctgtggtttctccgaggtaattaattattctttc
aacgctccggcggcgcttgacaggattgccctgcccgaacaggacgaacgccgttcccag
gtccgtctgctcaatccccttacggaagagcagtccgtcatgcgcaccacattggtgccc
agtgtcctacagaacgtcgcccagaatcttgcccgtcgcagcgccggcgatctgcgcctg
tttgaactcaggccagtctttcttcccgacggtggggacgatctgccccgcgaagtgcct
catctggtctttgccctgagcggcaggcgcagtccattggggtgggcgcagagttcggaa
ccggtcgatttcttcgatctcaaaggggtcgtcgaagagctcatggagcagctgcgcctc
gattcggtagaatattctccagaccagggcgagtcgttcctgcatcccggcaagtcctgc
gccttgacctgcaaccaggtggttttagggttgctgggtgaagttcatccgcaggtcctg
aaggaatttgagatcgaacagccggtctatatctgcgatctggatctcagtgcgattgcc
gatgtggcaggcaatcccgttgtttttaaagagctttcccgttttcccggagtcgatcgc
gacagcgccttgctggtggatgaagagatcgaagcgcgccgcattctggatgcggcgctc
aacgccagggcgcgcgatgtggaagatgtcgttctcttcgatgtctatcgcggcaaaggg
attccgcagggtaaaaagagcattgccatccgcgtacgctatcgccgggcggataaaact
ttgactgatgaagaggtcgccaagtctcattcgcgcatcatcaaagccctcgaaaatgag
ttaggtgccgaaattcgttga

DBGET integrated database retrieval system