KEGG   Geoalkalibacter subterraneus: GSUB_09590Help
Entry
GSUB_09590        CDS       T03585                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
gsb  Geoalkalibacter subterraneus
Pathway
gsb00071  Fatty acid degradation
gsb00280  Valine, leucine and isoleucine degradation
gsb00310  Lysine degradation
gsb00362  Benzoate degradation
gsb00380  Tryptophan metabolism
gsb00620  Pyruvate metabolism
gsb00630  Glyoxylate and dicarboxylate metabolism
gsb00640  Propanoate metabolism
gsb00650  Butanoate metabolism
gsb00900  Terpenoid backbone biosynthesis
gsb01100  Metabolic pathways
gsb01110  Biosynthesis of secondary metabolites
gsb01120  Microbial metabolism in diverse environments
gsb01130  Biosynthesis of antibiotics
gsb01200  Carbon metabolism
gsb01212  Fatty acid metabolism
gsb02020  Two-component system
Brite
KEGG Orthology (KO) [BR:gsb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    GSUB_09590
   00630 Glyoxylate and dicarboxylate metabolism
    GSUB_09590
   00640 Propanoate metabolism
    GSUB_09590
   00650 Butanoate metabolism
    GSUB_09590
  09103 Lipid metabolism
   00071 Fatty acid degradation
    GSUB_09590
   00072 Synthesis and degradation of ketone bodies
    GSUB_09590
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    GSUB_09590
   00310 Lysine degradation
    GSUB_09590
   00380 Tryptophan metabolism
    GSUB_09590
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    GSUB_09590
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    GSUB_09590
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    GSUB_09590
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gsb04147]
    GSUB_09590
Enzymes [BR:gsb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     GSUB_09590
Exosome [BR:gsb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GSUB_09590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AJF06743
UniProt: A0A0B5FH84
Position
complement(2079892..2081070)
Genome map
AA seq 392 aa AA seqDB search
MGSEVFVVEAKRTPFGSMGGTLSDVAAATLGATAMRAVLESSSVSVDAVDEVIVGQVLSG
GCGQAPARQAMRGVGIPDEVPALTINKVCGSGLKAVMLGADSIRLGESGVVVAGGMESMS
LAPYFLEKARTGYRMGNGKLIDLMIFDGLTDPYTGRHMGEIGEASVERNGLSREEQDDFA
LRSYRLAQTAVEEGIFARELVPVIKQNKKGEVRVETDEEPFKVDFDRLPCLKPVFRKDGT
ITAGNASTINDGAAMLLLAGKEALERHNLTARARIVAQATSSRHPDEFPEAPIGAIEKAC
ARAGLSVEDIDLFEINEAFASVALLAMKAHNIPIDKVNVNGGACAIGHPIGASGARLATT
LVHELDRRQKRYGLATLCIGGGEAVAVIFERI
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgggttcagaagtttttgttgttgaggcaaaacgaacacccttcgggtcaatgggggga
actctctccgatgtggcggcggccactctgggtgcgacggcaatgcgggcagtcctggag
tcatcatctgtttcagtcgatgccgtggatgaagtcattgtcgggcaggttctttcggga
gggtgcggccaggcaccggcgcgtcaggccatgcggggagttggcatccctgatgaggtg
ccggctctgaccatcaataaagtgtgtggcagcgggctcaaggcggtcatgcttggcgca
gattccatccgtcttggtgagtccggcgtggttgtcgccggcgggatggagagcatgtcg
ttggcaccgtattttctggaaaaagcccgcacaggctaccgcatgggaaacggtaagctt
atcgaccttatgatcttcgacggactgaccgatccctacacaggtcgccacatgggggag
atcggcgaagccagcgtggaacgcaacgggttgagtcgcgaggagcaggacgatttcgcc
ctgcgctcctatcggctcgcccagacggcggtggaggaggggatctttgctcgcgaactt
gttccggtcatcaagcagaataagaaaggcgaggtgcgcgtcgagaccgatgaagagccc
ttcaaggttgattttgaccgcctgccctgcctcaagcctgtttttcgcaaagacggcacc
atcacggccggtaacgcctcgaccatcaacgatggtgccgccatgctgctgctcgcaggg
aaagaggcgctcgagcggcacaacctgacggccagggcgcgtattgttgctcaggccaca
tcgagtcggcatcccgacgagtttcccgaggcccccatcggggcgatcgaaaaagcgtgc
gcgagagccgggctttcggtggaggacattgatctgtttgaaatcaatgaggcctttgcc
tcggtggcgctgctggccatgaaagctcacaatattcccatagacaaggtcaacgtcaac
ggtggcgcctgcgccatcggtcatcccatcggcgccagcggtgcgcggttggcaacgacc
ctcgttcacgagctggatcgccgtcagaagcgctatggcctggcgacgctctgtatcggt
gggggggaagccgtagctgtcatttttgaacgtatttaa

DBGET integrated database retrieval system