KEGG   Geoalkalibacter subterraneus: GSUB_12215Help
Entry
GSUB_12215        CDS       T03585                                 

Definition
(GenBank) tyrosine--tRNA ligase
  KO
K01866  tyrosyl-tRNA synthetase [EC:6.1.1.1]
Organism
gsb  Geoalkalibacter subterraneus
Pathway
gsb00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:gsb00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    GSUB_12215
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:gsb01007]
    GSUB_12215
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:gsb03016]
    GSUB_12215
   03029 Mitochondrial biogenesis [BR:gsb03029]
    GSUB_12215
Enzymes [BR:gsb01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.1  tyrosine---tRNA ligase
     GSUB_12215
Amino acid related enzymes [BR:gsb01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   GSUB_12215
Transfer RNA biogenesis [BR:gsb03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    GSUB_12215
 Prokaryotic type
    GSUB_12215
Mitochondrial biogenesis [BR:gsb03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    GSUB_12215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1b S4 TyrRSs_C S4_2
Motif
Other DBs
NCBI-ProteinID: AJF07167
UniProt: A0A0B5FGA6
Position
complement(2624403..2625623)
Genome map
AA seq 406 aa AA seqDB search
MLSVKQQMDVIRRGAVEILVESELEEKLREAIEVGRPLRIKAGFDPTAPDLHIGHTVLIQ
KLKQFQDLGHQICFLIGDFTAMIGDPTGKNETRKALTREQVLDNARTYQEQVFKILDPEK
TRLVFNSEWMGKMTAADLIQLAARHTVARMLERDDFHKRFQGQQPIAIHEFLYPLVQGWD
SVALEADVELGGTDQKFNLLVGRELQKQVGQRPQSILTMPLLEGLDGVNKMSKSLGNYIG
ITESPRDIYGKAMSISDELMVRYYELLSDVGLDALEKVRAGVAGKPDGAHPMESKKALAM
ELVARFHGQQAAEQAAEDFVRQFKKKEIPEEMPTLQVEASQPVWICRLLSDAGLVSSNGE
GRRLVRQGGVRIDGEKIDNPDLEVPAEGEIVLQAGKRKFARIVFSV
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgttatcagtcaaacagcaaatggatgtgatccgccgtggcgcggtagagatcctggtg
gagtcagaacttgaggaaaagctccgggaggcgatcgaggtcggtcgccctttgcgcatc
aaagcgggttttgatcccaccgcccctgatctgcatatcggccatacggttttgatccag
aagctcaagcagtttcaggatcttgggcatcagatctgttttctgatcggtgatttcacc
gccatgatcggcgaccccacgggaaagaatgaaacccgcaaggcgctgacccgcgagcag
gttctggacaacgctcgcacctatcaggagcaggtattcaagattcttgacccggaaaaa
acccggcttgttttcaacagtgagtggatgggcaagatgaccgccgcggatctgattcag
ctggccgcgcggcatactgtcgcgcgcatgctggagcgggatgatttccacaagcggttt
caggggcagcagccgatcgctatccatgagttcctctatcccctggtgcaggggtgggat
tctgttgccctcgaggcggatgtcgaactgggagggactgatcagaaattcaaccttctg
gtcgggcgcgagttgcagaaacaggtggggcagcgtccgcagagcatcctgaccatgccg
ctgctggaaggtctcgacggggtcaacaagatgagcaagagcctcggcaactacatcggc
atcaccgagtctccccgtgatatttacggcaaggccatgagtatctccgacgaattgatg
gttcgctactatgagctgctctccgatgtcggtcttgatgccctggaaaaagtccgggcc
ggcgtggcgggtaagccggacggtgcccatcccatggagagcaaaaaagcgctggccatg
gaactggtggcccgcttccatggccagcaggctgccgagcaggctgcggaggatttcgtt
cgtcagttcaaaaagaaggaaattcctgaagagatgccgacccttcaagtcgaagcctct
cagccggtctggatctgccggctgctctccgatgccgggctggtttcctccaacggcgaa
gggcgccgcctggtgcgtcaggggggggttagaattgatggtgaaaaaatcgacaatccc
gacctcgaagtccctgcggaaggtgaaattgttctgcaggcgggaaaaaggaagttcgca
cgcattgttttctccgtctga

DBGET integrated database retrieval system