KEGG   Geoalkalibacter subterraneus: GSUB_13260Help
Entry
GSUB_13260        CDS       T03585                                 

Definition
(GenBank) fructose-bisphosphate aldolase
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
gsb  Geoalkalibacter subterraneus
Pathway
gsb00010  Glycolysis / Gluconeogenesis
gsb00030  Pentose phosphate pathway
gsb00051  Fructose and mannose metabolism
gsb00680  Methane metabolism
gsb01100  Metabolic pathways
gsb01110  Biosynthesis of secondary metabolites
gsb01120  Microbial metabolism in diverse environments
gsb01130  Biosynthesis of antibiotics
gsb01200  Carbon metabolism
gsb01230  Biosynthesis of amino acids
Module
gsb_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
gsb_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:gsb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GSUB_13260
   00030 Pentose phosphate pathway
    GSUB_13260
   00051 Fructose and mannose metabolism
    GSUB_13260
  09102 Energy metabolism
   00680 Methane metabolism
    GSUB_13260
Enzymes [BR:gsb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     GSUB_13260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase OST-HTH MraZ
Motif
Other DBs
NCBI-ProteinID: AJF07334
UniProt: A0A0B5FRR1
Position
complement(2833458..2834438)
Genome map
AA seq 326 aa AA seqDB search
MSDTVSYTELGLANTREMFKKAVGGGYAIPAYNFNNLEQLQAIITACAETSSPVIVQVSK
GARDYANETMLRYMALGAVRMAREMGSNIPIALHLDHGDSFELCKSCVDSGFSSVMIDGS
HLPYEENVKLTRQVVEYAHQHDVTVEGELGVLAGIEDEVQAETSTYTKPEEVEDFVSKTG
VDSLAISIGTSHGAYKFKLKEGEEVPPLRFDILEEIERRIPGFPIVLHGASSVLQEYVQL
INNYGGKMEGAVGVPEEQLRRAAASAVCKINIDSDGRLAVTAKVREYLSQHPEEFDPRKY
LGVARKELIKLIKHKNETVLGSAGRA
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacaccgtcagctacacagagctcggactggccaacacccgcgagatgttcaaa
aaggccgtggggggaggctatgcaattccagcatataattttaacaacctcgagcagctg
caggcgatcattacggcatgtgctgaaacatcttcgccggtgattgtgcaggtcagcaag
ggggcccgggactacgccaatgagaccatgctgcgctacatggccctgggcgcggtgcgc
atggcgcgcgaaatgggcagcaacattcccatcgctctgcatctcgatcatggcgattcg
ttcgaattatgcaagtcctgtgtggactccggtttttcttcggtcatgatcgatggttcg
catctgccttacgaggaaaacgtcaagctgacccgccaggtcgttgaatatgcccatcag
cacgacgtgaccgtcgaaggggagctgggtgtgctggccggcatcgaggacgaggttcag
gcggagacttcgacttacaccaagcccgaagaggtcgaggattttgtctccaagaccggc
gtcgattccctggcgatttccatcggaaccagtcacggcgcgtacaagttcaagctgaag
gaaggtgaagaagttccgcccctgcgcttcgatatcctcgaggagatcgagcgccgcatt
cccggctttcccattgtcctgcacggcgcttcgagcgtgctgcaggagtatgtccagctg
atcaacaattacggcggcaagatggaaggtgcggtcggcgttccggaagagcagctgcgc
cgtgcggcggccagtgccgtgtgcaagatcaacatcgactccgatggtcgcctggctgtg
accgccaaggtacgtgaatatctcagccagcaccccgaggagttcgacccccgcaaatat
ctcggggtggcgcgcaaggagctgatcaagctgatcaagcacaagaatgagacggtgctg
gggagtgccggacgggcttga

DBGET integrated database retrieval system