KEGG   Geoalkalibacter subterraneus: GSUB_15835Help
Entry
GSUB_15835        CDS       T03585                                 

Definition
(GenBank) phosphoenolpyruvate carboxykinase
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
gsb  Geoalkalibacter subterraneus
Pathway
gsb00010  Glycolysis / Gluconeogenesis
gsb00020  Citrate cycle (TCA cycle)
gsb00620  Pyruvate metabolism
gsb01100  Metabolic pathways
gsb01110  Biosynthesis of secondary metabolites
gsb01120  Microbial metabolism in diverse environments
gsb01130  Biosynthesis of antibiotics
gsb01200  Carbon metabolism
Module
gsb_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:gsb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GSUB_15835
   00020 Citrate cycle (TCA cycle)
    GSUB_15835
   00620 Pyruvate metabolism
    GSUB_15835
Enzymes [BR:gsb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     GSUB_15835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_18 AAA_16 PEPCK_GTP AAA_33 AAA_25 AAA_24
Motif
Other DBs
NCBI-ProteinID: AJF07731
UniProt: A0A0B5FVX0
Position
complement(3369139..3370734)
Genome map
AA seq 531 aa AA seqDB search
MDNAGKAEVSAQELGLNSVGEIYHNLGYDELFEHETRNEEGRVAANGTMMVDTGKFTGRS
PKDKYFVHQKPSFEHIAWGKINQPMAPEVFDELYGEVTSYLDGKNLYVTDGFCGANEKTR
KAVRFITEFAWQSHFVKNMFIRPSEEELKNFKPDFTVYNASNLVNADWERHGLNSEVFVS
FNIEKDVAIIGGTWYGGEMKKGIFTMMNYWLPLQGILSMHCSANVGKDGDVCLFFGLSGT
GKTTLSTDASRKLIGDDEHGWDDDGIFNFEGGCYAKCINLSKESEPEIYNAIRRNALLEN
VVSNDDGVIDFDDSSKTENTRVSYPIEHIENHEPSLKGDHPKNIIFLTCDAFGVLPPVSK
LTKEQAMYYFLSGYTAKVAGTERGVTEPQATFSACFGEAFLPLPPTVYAKLLGEKMEKHN
VNAYLVNTGWVGGGYGVGKRMSIKATRACVNAILDGSIEKAEFEQTRWFRLNIPKALPGV
DSALLNPRNAWPNKEDFDNSANRLAGMFIDNFKKYIKDSDDFDFTQAGPRR
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atggacaacgcaggcaaggcagaggtcagtgcgcaggagttgggattgaacagcgtgggc
gagatctaccacaacctgggctacgatgagctgttcgagcacgagacacgcaacgaggag
gggcgggttgccgccaacggtaccatgatggtggacacgggcaagttcaccggccgctcc
cccaaggacaagtatttcgtccatcagaagccttccttcgaacatatcgcctggggcaaa
atcaaccagcccatggctcccgaagttttcgacgaactctacggcgaggtgaccagctac
ctcgacggtaaaaatctttatgtcaccgacggtttctgcggcgccaacgaaaaaacccgc
aaggcggtgcgtttcatcaccgagttcgcctggcagtctcatttcgtcaagaacatgttc
atccgccccagtgaagaggagctgaagaatttcaagcccgacttcaccgtctacaacgcc
agcaacctggtcaacgccgactgggagcgccacggcctcaattccgaggtgttcgtcagc
ttcaacatcgaaaaggatgtggcgatcatcggcggcacctggtacggcggtgagatgaaa
aaaggcatcttcaccatgatgaactactggctgccgctgcaggggatcctctccatgcac
tgctcggccaacgtgggcaaggacggcgatgtgtgcctgttcttcggcctgtccggcacc
ggcaaaaccaccctctccaccgatgcctcgcgcaagctgatcggcgacgacgagcacggc
tgggacgatgacgggattttcaacttcgaaggcggctgctacgccaagtgcatcaacctt
tcgaaagagagcgagccggagatctacaacgccatccgccgcaacgcactgctcgagaac
gtggtgtccaatgacgacggcgtgatcgattttgatgacagctccaaaacggaaaacacc
cgcgtttcctatcccatcgagcatatcgaaaaccacgagccgagcctcaagggggatcat
cctaaaaacatcatcttcctgacctgcgatgccttcggcgtactgcccccggtcagcaag
ctgaccaaagagcaggccatgtactacttcctgagcggctataccgccaaggtggccggt
accgaacgcggtgtgaccgagccgcaggcgaccttctccgcctgcttcggggaagccttt
ctgccgctgccccccaccgtctatgccaagctgctgggcgaaaagatggagaagcacaat
gtcaacgcctacctggtcaataccggatgggtcggcggcggctacggcgtcggcaaacgc
atgagcatcaaggcgacccgcgcctgcgtcaacgcgattctcgacggcagcatcgaaaaa
gccgagttcgagcagacccgctggttccgcctgaacatccccaaggctctgccgggggtc
gacagcgcgctgctcaatccccgcaatgcctggcccaacaaggaagacttcgataacagc
gccaaccggttggccgggatgttcatcgacaatttcaagaagtacatcaaggacagcgac
gacttcgatttcacccaggccggaccccggcgctga

DBGET integrated database retrieval system