KEGG   Geobacillus stearothermophilus: GT50_04805Help
Entry
GT50_04805        CDS       T04043                                 

Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
gse  Geobacillus stearothermophilus
Pathway
gse00471  D-Glutamine and D-glutamate metabolism
gse01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gse00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    GT50_04805
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:gse01011]
    GT50_04805
Enzymes [BR:gse01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     GT50_04805
Peptidoglycan biosynthesis and degradation proteins [BR:gse01011]
 Precursor biosynthesis
  Racemase
   GT50_04805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: ALA69604
UniProt: A0A0K2H6C7
Position
complement(906541..907335)
Genome map
AA seq 264 aa AA seqDB search
MERAIGVIDSGVGGLTVAKEIMRQLPKEQIIYLGDTARCPYGPRPVEEVRRFTWQMIDYL
RQYPLKMLVIACNTATAVALDDVRAKLDIPVLGVIHPGARAALKATRRGHIGVIGTIGTI
RSRAYEKALQSINPRVQVESLACPKFVPLVESGDFEGQEAMAIVAESLAPLRPLPIDVLI
LGCTHYPLLAPLIRTYMGKRVKLICSGGETAREVSAILHHSQLLYTGEREPEHLFFTTGP
KELFEKISGKWFGKPIGTVEAIRL
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
ttggaaagagcaattggtgtcattgactcaggagtcggcggtttgaccgtcgccaaagaa
attatgaggcagctgccgaaagaacaaattatttacttaggcgacaccgcccgttgcccg
tacgggccgcggccggtggaagaagtccgtcgatttacgtggcaaatgattgattacttg
cggcaatatcccttgaaaatgcttgttatcgcctgcaacaccgcgacggcggtcgcgctt
gacgacgtgcgggcgaagcttgacattcctgtgcttggcgttattcatcccggcgctcgc
gccgccctgaaagcgactaggcgcgggcacatcggcgtcatcggcacgattggcacgatc
cgaagccgggcgtatgaaaaggcgcttcaatccatcaatccgcgcgtccaagtcgagagc
ttggcctgtccgaaattcgttccgcttgtggaaagcggcgactttgaagggcaggaggcg
atggcgatcgtcgccgaatcgctcgctccgctccgtccgctgccgatcgatgtgctgatt
ttaggctgcacgcattatccgttgctcgcgccgctcattcgcacgtatatgggcaaacgc
gtgaagctcatttgctcgggcggtgagacggctcgtgaagtgagcgcgattttgcaccac
agccagctcctttacaccggcgagcgcgaaccggagcatttgtttttcacgaccgggccg
aaagagctgtttgaaaagatttccgggaagtggtttggcaagccgatcggcacggtcgaa
gcgattcggctgtaa

DBGET integrated database retrieval system