KEGG   Geobacillus stearothermophilus: GT50_05165Help
Entry
GT50_05165        CDS       T04043                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
gse  Geobacillus stearothermophilus
Pathway
gse00020  Citrate cycle (TCA cycle)
gse00480  Glutathione metabolism
gse01100  Metabolic pathways
gse01110  Biosynthesis of secondary metabolites
gse01120  Microbial metabolism in diverse environments
gse01130  Biosynthesis of antibiotics
gse01200  Carbon metabolism
gse01210  2-Oxocarboxylic acid metabolism
gse01230  Biosynthesis of amino acids
Module
gse_M00009  Citrate cycle (TCA cycle, Krebs cycle)
gse_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:gse00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GT50_05165
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    GT50_05165
Enzymes [BR:gse01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     GT50_05165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ALA69671
UniProt: A0A0K2H7I3
Position
complement(975255..976526)
Genome map
AA seq 423 aa AA seqDB search
MTQGEKITVQNGVLNVPNNPIIPFIEGDGTGPDIWAAASRVLEAAVEKAYKGEKKIVWKE
VLAGEKAYKLTGSWLPDETLETIREYIIAIKGPLTTPVGGGIRSLNVALRQELDLFVCLR
PVRYFPGVPSPVKRPEDTDMVIFRENTEDIYAGIEYAKGTPEVKKVIDFLQNEMGVRKIR
FPETSGIGIKPISEQGTKRLVRAAINYAIEHGRKSVTLVHKGNIMKFTEGAFKNWGYELA
EEEFADKVFTWAQYDRIVETEGKEAANKALADAEASGKIIIKDVIADIFLQQILTRPREF
DVIATMNLNGDYISDALAAQVGGIGIAPGANINYETGHAIFEATHGTAPKYAGLDKVNPS
SVILSGVMMFEHLGWNEAAKLIIKAMEKTIAAKIVTYDFARLMEGATEVKCSEFADALIR
NMD
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcaaggagaaaaaattacagtccaaaatggtgtgctcaacgttccgaacaacccg
atcattccgttcatcgagggggatggaaccggcccggacatttgggcggccgcttcgcgc
gtgctcgaagcagcggtggaaaaagcgtacaaaggtgagaaaaaaatcgtttggaaggaa
gtgctcgctggtgaaaaagcgtacaagctgacgggcagctggcttccggatgaaacgctt
gagacgatccgcgaatacataatcgccattaaagggccgttgacgacgccggtcggcggc
ggcatccgctcgctgaacgtcgcgctccgccaagagctcgacctgtttgtctgcttgcgc
ccggttcgctacttcccaggcgttccgtcgccggtgaaacgcccggaagacaccgatatg
gtcattttccgggaaaacacggaagacatctacgctggcattgaatatgccaaaggcacg
ccggaagtgaaaaaagtcatcgactttttgcaaaacgaaatgggcgtgcgcaaaatccgc
ttcccggaaacgtccggcatcggcattaaaccgatttccgaacaagggacgaaacggctt
gtgcgcgcggcgatcaactacgcgatcgaacacggccgcaagtcggtgacgctcgttcat
aaagggaatattatgaaattcaccgaaggcgcgtttaaaaactggggttatgaactggcg
gaggaagaattcgccgacaaagtgttcacgtgggcgcaatacgaccgaatcgttgaaacg
gaaggcaaggaagcggcgaacaaagcgcttgctgatgcggaagcgtccggcaaaatcatt
atcaaagatgtcatcgccgacatcttcctgcaacaaattttgacgcgtccgcgcgaattt
gacgtcatcgcgacgatgaacttaaacggcgactacatttccgacgcgctggccgctcaa
gtcggcggcatcggcatcgcgccgggggcaaacatcaactacgaaaccggccacgcgatt
ttcgaagcgacgcacggcacggcgccgaaatacgcagggcttgacaaagtcaacccgtcg
tccgtcattctctcgggcgtcatgatgtttgagcatcttggttggaacgaagcagcgaaa
ttgatcatcaaagcgatggagaaaaccatcgccgcgaaaatcgtcacgtatgacttcgcc
cgcctgatggaaggggcgacggaagtgaaatgctccgaatttgctgatgcgctcatccgc
aatatggactaa

DBGET integrated database retrieval system