KEGG   Geobacillus stearothermophilus: GT50_10455Help
Entry
GT50_10455        CDS       T04043                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
gse  Geobacillus stearothermophilus
Pathway
gse00010  Glycolysis / Gluconeogenesis
gse00053  Ascorbate and aldarate metabolism
gse00071  Fatty acid degradation
gse00280  Valine, leucine and isoleucine degradation
gse00310  Lysine degradation
gse00330  Arginine and proline metabolism
gse00340  Histidine metabolism
gse00380  Tryptophan metabolism
gse00410  beta-Alanine metabolism
gse00561  Glycerolipid metabolism
gse00620  Pyruvate metabolism
gse00625  Chloroalkane and chloroalkene degradation
gse01100  Metabolic pathways
gse01110  Biosynthesis of secondary metabolites
gse01120  Microbial metabolism in diverse environments
gse01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:gse00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GT50_10455
   00053 Ascorbate and aldarate metabolism
    GT50_10455
   00620 Pyruvate metabolism
    GT50_10455
  09103 Lipid metabolism
   00071 Fatty acid degradation
    GT50_10455
   00561 Glycerolipid metabolism
    GT50_10455
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    GT50_10455
   00310 Lysine degradation
    GT50_10455
   00330 Arginine and proline metabolism
    GT50_10455
   00340 Histidine metabolism
    GT50_10455
   00380 Tryptophan metabolism
    GT50_10455
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    GT50_10455
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    GT50_10455
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    GT50_10455
Enzymes [BR:gse01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     GT50_10455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh PhageMin_Tail SLATT_2
Motif
Other DBs
NCBI-ProteinID: ALA70564
UniProt: A0A0K2H953
Position
1958279..1959820
Genome map
AA seq 513 aa AA seqDB search
MTIDVQMHHFPLFIDGQWQPASSGETFNVYNPATGEAVATVAKATADDVDRAVKAARKAF
DETDWKAMKPKERARVLNVIAQAIAANAQELAYLEAISSGGTIRRISSIDILQTVDLFQT
MANIVQEYPFSETLPIPPFPGPAHNFVWREPIGVCAAITPWNLPLMIASWKIAPALAAGN
TIVVKPASYTPLSTLKLAEIISSFVPPGVINVVAGPGADVGEALVRHPQVDKVAFTGSTE
VGRRIMALAAETVKNVTLELGGKSPNILLEDADLDIAVPGSLFGVFLHSGQLCESGTRLF
VPDRLHDEVVERLAALTKTLQIGHPLDPATDVGPVISKRQKETVLSYIEAGKQEGATIVC
GGHEVEVPGCEGGHFVAPTIFSNVTNDMKIAQEEIFGPVLSIIRYHDVEEAVAMANDTIY
GLAAGVWTRDVNKAYAIAGRLQAGVVWINDWHMLRNDAPFGGYKQSGIGREMGKYSLDAY
TQLKHVHTSMVPELEKRKWYQVLFSRLHTMMKK
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgacgattgacgtgcaaatgcatcattttccgctcttcattgacggccaatggcagccg
gcaagcagcggggaaacgtttaacgtatacaatccggcgaccggagaggcggtggcgacc
gtcgcgaaggcgacagcggatgatgttgaccgggcggtgaaggcggcgcgcaaggcgttt
gacgagaccgattggaaggcgatgaaaccgaaagaacgggcgcgcgtgctgaatgtgatc
gcccaagccattgccgccaacgctcaagagctcgcctatttggaggcaatctcaagcgga
gggacgatccggcgcatcagctcgatcgatattttgcagacggtcgatttattccaaacg
atggcaaacatcgtccaagagtacccgttttcggaaacactgccgattccgccgtttccc
ggaccggcgcacaactttgtctggcgcgagccgatcggggtttgcgcggcgatcacacca
tggaacttgccgctcatgatcgcgtcgtggaaaatcgccccggcgctggcagcgggcaat
acgatcgtcgtgaaaccggcgagctacacaccgctgtcgacactgaagctggcagaaatc
atttcgtcctttgtgccgccgggggtcatcaacgtggtggctggtccgggcgccgacgtc
ggtgaggcgcttgtccgccatccgcaagtggacaaggtggcgttcaccggttcgacggaa
gtcggccgccgcattatggcgttggcggcggaaacggtgaaaaacgttacgcttgaactt
ggcggcaagtcgccgaacattttgctcgaagatgctgatttggacattgccgttcccggc
agtttgtttggcgtctttttgcattctggtcagttgtgcgaatcgggaacaaggctgttt
gtgcctgaccggctccatgatgaagtggtcgagcggcttgccgcgctgacgaagacgctg
caaatcggccatccgcttgatccggcgaccgacgtcgggccggttatctccaagcggcaa
aaagagacagtgctctcctatattgaagccggcaaacaagaaggtgcgaccattgtatgc
ggcggtcatgaagtcgaagtgcccggctgtgaaggcggccattttgtcgcgccgacgatt
ttttcgaatgtcacgaatgacatgaaaatcgcccaagaagagattttcggtccagtgttg
tcgatcatccgctatcatgacgtggaagaagcggtggcgatggccaacgacacgatctac
gggcttgcggccggcgtctggacgcgcgacgtcaacaaggcgtacgccatcgccgggcgc
ctgcaggctggcgtcgtctggatcaatgactggcatatgcttcgcaatgacgcgccgttt
ggcggctacaaacaaagcggcatcgggcgcgagatgggcaaatattcacttgatgcttac
acgcagctgaagcatgtgcacacatcaatggtgccggagcttgaaaagcggaaatggtat
caagtgctgttttcccgcctgcacaccatgatgaaaaagtaa

DBGET integrated database retrieval system