KEGG   Geobacillus stearothermophilus: GT50_11850Help
Entry
GT50_11850        CDS       T04043                                 

Definition
(GenBank) sirohydrochlorin ferrochelatase
  KO
K03794  sirohydrochlorin ferrochelatase [EC:4.99.1.4]
Organism
gse  Geobacillus stearothermophilus
Pathway
gse00860  Porphyrin and chlorophyll metabolism
gse01100  Metabolic pathways
gse01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gse00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    GT50_11850
Enzymes [BR:gse01000]
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     GT50_11850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CbiX CbiK
Motif
Other DBs
NCBI-ProteinID: ALA70791
UniProt: A0A0K2HAR6
Position
complement(2242074..2242820)
Genome map
AA seq 248 aa AA seqDB search
MEAVLYVSHGSRIAAARHEAARFVEQCRRAIDIPIQELCFVELAEPDIVTGVDRCVAQGA
TRVIVVPLLLLSAGHAKHDIPAALDIARRRHPSVDILCGAPFGVHEAMIDIMIDRISEQS
APLDGESMILLVGRGSSDPDTKRDMSAIAALLKEKTNVPHVDVCFLAAIRPTLDEGLERA
HASAYRRVFVVPYLLFTGVLMKTIERKLQGFSVSDKQWHLCSYLGDHPRLVLLIQQQVLS
LSSVKKGA
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggaagctgttttatatgtcagccacggcagccgcattgccgccgcgcgccatgaagcg
gcgcgtttcgtcgaacagtgccggagggccatcgatattccgattcaagagctatgcttt
gtcgagctcgcggaaccggacattgtcaccggcgttgaccgttgtgtcgcccaaggggcg
acacgcgtcatcgtcgttccgcttctccttctttctgcagggcatgccaaacacgatatt
ccagcggcattggacatcgcgagacggcgccatccgtccgttgatatcctctgcggcgct
ccgttcggcgtccatgaagcgatgatcgacatcatgatcgaccgcatcagcgaacagtcc
gcaccgcttgacggcgaatcgatgatccttcttgtcggccgcggcagcagtgatccagac
acgaagcgcgacatgtccgccatcgctgcgcttttaaaagaaaaaacgaacgtgccgcac
gtggacgtttgttttctcgctgccatccgcccgacgcttgatgaagggctcgaacgggcc
catgcatcggcgtatcggcgtgtgtttgtcgtcccgtacttattgtttaccggcgtctta
atgaaaacgatcgaacggaagttgcaggggttctctgtttccgacaaacagtggcattta
tgctcttacctaggcgatcacccgcggcttgtgctgctcattcaacaacaagtattatcg
ctatcatccgtaaaaaaaggagcttga

DBGET integrated database retrieval system