KEGG   Geobacillus stearothermophilus: GT50_17480Help
Entry
GT50_17480        CDS       T04043                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
gse  Geobacillus stearothermophilus
Pathway
gse00650  Butanoate metabolism
gse00900  Terpenoid backbone biosynthesis
gse01100  Metabolic pathways
gse01110  Biosynthesis of secondary metabolites
gse01120  Microbial metabolism in diverse environments
gse01130  Biosynthesis of antibiotics
gse01200  Carbon metabolism
gse01212  Fatty acid metabolism
gse02020  Two-component system
Brite
KEGG Orthology (KO) [BR:gse00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    GT50_17480
   00630 Glyoxylate and dicarboxylate metabolism
    GT50_17480
   00640 Propanoate metabolism
    GT50_17480
   00650 Butanoate metabolism
    GT50_17480
  09103 Lipid metabolism
   00071 Fatty acid degradation
    GT50_17480
   00072 Synthesis and degradation of ketone bodies
    GT50_17480
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    GT50_17480
   00310 Lysine degradation
    GT50_17480
   00380 Tryptophan metabolism
    GT50_17480
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    GT50_17480
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    GT50_17480
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    GT50_17480
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gse04147]
    GT50_17480
Enzymes [BR:gse01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     GT50_17480
Exosome [BR:gse04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GT50_17480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ALA71742
UniProt: A0A0K2HCJ8
Position
3309413..3310582
Genome map
AA seq 389 aa AA seqDB search
MRRDAVIVSAVRTAIARQGGALATMPAHIYGAEVIKEAMRRANIGPEHVDDVIMGNVLSG
GGNIARLTALQTGLSLELTGVTVDRQCGSGINAVNLAAQAIWAGDGDVYIAGGVESMSRA
PYLMDRPEKPYSSTPPSFRKSQLSPKEIGDPPMGITAENLAKKYGISREEQDAFALRSQQ
RMARAMQEGRFDEQIVPIAVPVKKGEPFIFDTDEHPRPNTTMEALAKLPPAFLEGGTVTA
GNSSGLNDGASALVIMSREKAEELGLKPLAAIRAHAVAGVDPNIMGIGPVPATRKVLEKA
GLTLDEMDIIEINEAFAAQVIACDRELEMDPEKVNINGGAIAHGHPLGATGAILITKAVY
ELKRRGGKYALITACIGGGQGIATIIERE
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgagacgagatgccgtcattgtgtcggccgtacgaacggccatcgcccgccaaggtggc
gctttggcgacgatgccggcgcatatttacggcgcggaagtgatcaaagaagcgatgcgg
cgggcgaatattggtccggagcatgtcgatgatgtcattatgggcaacgtcctaagcggc
ggcggcaatatcgcccgactgaccgcgctgcaaaccggactgtcgcttgagctgacggga
gtgacggtcgaccggcagtgcggttcgggcattaacgccgtcaatttagcagcgcaagcc
atttgggccggcgacggagatgtgtatattgccggcggcgtggaaagcatgagccgcgcg
ccgtatttgatggaccgcccggaaaaaccgtacagctcgacgccgccaagcttccgcaaa
tcgcagctatcgccgaaagaaatcggcgatccgccgatggggattacggcggaaaactta
gcgaaaaaatacggcatcagccgtgaagaacaagacgcattcgccttgcgcagccagcag
cgcatggcgcgcgccatgcaggaagggcgatttgacgagcaaattgtgcccattgccgtg
ccggtgaaaaaaggggagccgttcatcttcgatacggacgaacatccgcggccaaacaca
accatggaagcgctcgcaaaactgccgccggcgtttttggaaggcggaacggtgacggcc
gggaacagttccggattgaacgacggggcgtcggcgctcgtcatcatgtcgcgggaaaaa
gcagaggagcttggcttaaagccgcttgccgccatccgcgcccatgcggtcgccggagtt
gatccgaacatcatgggcattggcccggtgccggcgacaagaaaagtgcttgaaaaggcg
gggctgacgcttgatgagatggacatcattgaaatcaatgaagcgtttgccgcgcaagtg
atcgcctgcgaccgtgagcttgagatggatcccgaaaaagtgaacataaacggcggcgcc
atcgcccatggccatccgctcggcgcgacgggggcgattttgatcacaaaagcggtgtat
gaactgaagcgccgcggagggaaatacgcgctcattaccgcgtgcatcggcggcggtcaa
ggcattgcgaccatcattgagagagaatga

DBGET integrated database retrieval system