KEGG   Geobacillus stearothermophilus: GT50_17955Help
Entry
GT50_17955        CDS       T04043                                 

Definition
(GenBank) 5'-nucleotidase
  KO
K01081  5'-nucleotidase [EC:3.1.3.5]
Organism
gse  Geobacillus stearothermophilus
Pathway
gse00230  Purine metabolism
gse00240  Pyrimidine metabolism
gse00760  Nicotinate and nicotinamide metabolism
gse01100  Metabolic pathways
gse01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gse00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    GT50_17955
   00240 Pyrimidine metabolism
    GT50_17955
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    GT50_17955
Enzymes [BR:gse01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     GT50_17955
CD molecules [BR:gse04090]
 Proteins
  GT50_17955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 5_nucleotid_C Metallophos
Motif
Other DBs
NCBI-ProteinID: ALA71819
UniProt: A0A0K2HCR9
Position
complement(3396088..3397710)
Genome map
AA seq 540 aa AA seqDB search
MKNSKRWGRRVLSALAAAAVLAAAPVGAAGNGKSKGKPPASSHRYIEVQLLGINDFHGQL
NVTRKVGGREVGRADYLAAYLKQREAENKNTLLVHAGDAVGASPPVSALLQDEPTIEVLN
KLGFDVGTLGNHEFDEGVAEMLRLIHGGYHPATGDFAGADFPYVSANVVDAQTGKPILPP
YVIKRVNGMPIGLIGVTLTETPMIVTPSGVAGVKFIDEATAINKAVRELKKKGVQTIVVL
AHNPGVSNPDGTNASGEIVDIAKNVDDEVDVIFAGHNHAYLNAVVDGKLLVQSYSYGTAF
SDVDLKIDPRTKDVVAKKAEIVTTYHDGITPDPEIRALVEKYEAKVAPLVNQVVGTAAET
ITDEQNESGESALGNLIADAQRAAMKTDFAFMNPGGIRADIEQGEVTWGELYNVQPFNNQ
LVKMTLTGAQIRQLLNQQWQPTQTRMLQISGLRYTWSASRPAGDRVVDIQLPDGTPLHPD
AEYTVTVNSFLADGGDGFTVLTQGQHREVGPVDLDALVTYIRQLSQPFSAQIEGRITKLQ
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgaagaattccaaacgatggggaagacgggtgctatccgcattggctgctgcagcggtg
ctggccgcggctccagttggggcggcagggaacgggaaaagcaaggggaagccgcctgct
tcctcgcaccgttatattgaggtgcagctgttaggcattaacgacttccacggtcagttg
aatgtgacgagaaaagtcggcgggcgggaagtcggacgggctgattatttggccgcttat
ttgaaacagcgggaggcggaaaacaaaaatacgctgctcgtccatgccggcgatgcggtt
ggcgccagcccgccggtatcggcgttgctgcaggacgagccgacgatcgaagtgctcaat
aagctcggctttgacgtcggcacccttggcaaccatgagtttgatgaaggagtagcggaa
atgctccgcttgatccatggcggatatcacccggcgaccggcgatttcgccggagcagat
tttccgtacgtgagcgccaatgtcgttgatgcgcaaacgggaaagccgattctcccgcca
tatgtgattaagcgggtcaacggcatgccgatcggattgatcggcgtcacgctcacggaa
acaccaatgattgtgacgccaagcggcgtcgcgggagtcaagttcatcgatgaagcaaca
gcgattaacaaagcggtccgggaactgaagaaaaaaggggtgcaaacgatcgtcgttctc
gcccataacccaggcgtatccaatccggatgggacaaacgcaagcggggaaattgtcgat
atcgccaaaaatgtcgatgatgaagtcgatgtgattttcgccggtcataaccatgcctat
ttaaatgcggttgtggacggcaagctgctcgttcagtcgtattcgtacggcacggcgttt
tctgatgtcgatttgaaaatcgacccgcgtacgaaagacgtcgtcgccaaaaaagcggag
atcgtgacgacatatcatgacggcatcactccggacccggaaatccgtgccctcgtcgaa
aaatatgaagcgaaagtggcgccgcttgtcaatcaagtcgtcggcacagcagccgaaacg
atcaccgatgaacaaaacgaaagcggcgagtccgccttgggcaatttgatcgccgatgcc
cagcgggcggcgatgaaaaccgattttgcctttatgaacccgggcggcattcgcgccgat
attgaacaaggcgaagtgacgtggggcgaattgtacaacgttcagccgttcaacaaccag
ctcgtgaaaatgacgctcaccggcgcgcaaatccgccagcttttgaatcaacaatggcag
ccaacccaaacgcgcatgctgcaaatctccggcctccgctatacatggagcgccagcaga
ccagcaggggacagagtcgtcgatattcagctgccagatggcaccccgcttcatccagac
gctgaatatacggtaacggtcaacagctttctcgctgatggtggcgatgggttcaccgtg
ctgacgcaagggcaacaccgcgaggtcggtccggtcgatttggatgcacttgtcacttac
atccgccagttgtcacagccgttttcggcacaaatcgaagggcggatcacaaaactgcaa
tag

DBGET integrated database retrieval system