KEGG   Glycine soja (wild soybean): 114369413Help
Entry
114369413         CDS       T06057                                 

Definition
(RefSeq) probable pterin-4-alpha-carbinolamine dehydratase, chloroplastic
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
gsj  Glycine soja (wild soybean)
Pathway
gsj00790  Folate biosynthesis
gsj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gsj00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    114369413
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gsj04147]
    114369413
Enzymes [BR:gsj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     114369413
Exosome [BR:gsj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   114369413
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-GeneID: 114369413
NCBI-ProteinID: XP_028182445
Position
10
AA seq 216 aa AA seqDB search
MAITGNLNFNLNLVLPVARHMACPPRVPSFLFTRGRGAWSPSLLVTRAIDANEFLGDFGA
RDPFPAELESSFGDKVLGYGNTEHKILIPTITALGLSQQECAPVSSAQPPISLDDAQTLI
RKVVGWRLVNEENGLKIQCLWKLRDFKCGVELINRISKVVEAEGHFPNIYLEQPNQVRAE
LWTASIGGLSMNDFIVAAKIDQIKTSDLVPRKRVWA
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggccatcacaggcaaccttaacttcaacctcaacctagtacttcctgtggcacgccat
atggcgtgccctccacgcgtcccgtcgtttctcttcactcgcggtcgaggcgcgtggtcc
ccctcgcttctggtcacgcgcgccatcgacgctaacgagtttctgggggatttcggggcg
cgggaccctttccccgccgagcttgaaagctcgttcggggacaaagtgctgggatacggc
aacactgagcacaagattcttattcccaccattactgctctcggtctctcgcagcaggag
tgtgctcccgtttcttctgcgcagccccccatctcgctggatgacgcccagactctcatt
agaaaggttgtgggttggagacttgtgaatgaggaaaatggacttaaaattcaatgcttg
tggaaattgagagattttaaatgtggggttgaactcattaacaggatctctaaggttgta
gaggctgagggccatttcccaaatatctacttggagcaaccaaatcaagtgagagcagaa
ctatggacagcttccattggaggtttaagtatgaatgattttattgttgctgcaaagata
gatcagataaagacatcagatcttgtcccaaggaaaagggtttgggcgtaa

DBGET integrated database retrieval system