KEGG   Glycine soja (wild soybean): 114370161Help
Entry
114370161         CDS       T06057                                 

Definition
(RefSeq) probable mediator of RNA polymerase II transcription subunit 37c
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
gsj  Glycine soja (wild soybean)
Pathway
gsj03040  Spliceosome
gsj04141  Protein processing in endoplasmic reticulum
gsj04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:gsj00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    114370161
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    114370161
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    114370161
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:gsj01009]
    114370161
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:gsj03041]
    114370161
   03009 Ribosome biogenesis [BR:gsj03009]
    114370161
   03110 Chaperones and folding catalysts [BR:gsj03110]
    114370161
   04131 Membrane trafficking [BR:gsj04131]
    114370161
   03051 Proteasome [BR:gsj03051]
    114370161
   03029 Mitochondrial biogenesis [BR:gsj03029]
    114370161
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gsj04147]
    114370161
Protein phosphatases and associated proteins [BR:gsj01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     114370161
Spliceosome [BR:gsj03041]
 Complex B
  Other components
   Prp19 complex
    114370161
 Complex C
   Prp19-CDC5 complex
    114370161
Ribosome biogenesis [BR:gsj03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    114370161
Chaperones and folding catalysts [BR:gsj03110]
 Heat shock proteins
  HSP70 / DNAK
   114370161
Membrane trafficking [BR:gsj04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    114370161
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    114370161
Proteasome [BR:gsj03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    114370161
Mitochondrial biogenesis [BR:gsj03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    114370161
Exosome [BR:gsj04147]
 Exosomal proteins
  Proteins found in most exosomes
   114370161
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70
Motif
Other DBs
NCBI-GeneID: 114370161
NCBI-ProteinID: XP_028183249
Position
2
AA seq 104 aa AA seqDB search
MAKENQGFAIGIDLGTTYSCVAVWLEQHNRVEIIHNDQDAKRLIGRKHSDPTIQKVKMMW
PFKIVAGVNDKPIIIVNYKGKEKHLWAEEVSSMILLKMKEIAEA
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
atggccaaagaaaaccagggatttgccataggaatagaccttggtacaacctactcgtgt
gttgcagtgtggctggagcaacataatagagtagaaataatccacaacgaccaagatgct
aagaggctaattggtaggaaacatagtgatcccactattcaaaaggtcaaaatgatgtgg
ccattcaagattgttgctggtgtcaatgataaaccaattattattgttaattacaagggt
aaggagaagcacctttgggctgaggaagtatcatctatgatcctcctgaagatgaaagag
attgcagaggcgtag

DBGET integrated database retrieval system