KEGG   Glycine soja (wild soybean): 114370435Help
Entry
114370435         CDS       T06057                                 

Definition
(RefSeq) PTI1-like tyrosine-protein kinase At3g15890
Organism
gsj  Glycine soja (wild soybean)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH
Motif
Other DBs
NCBI-GeneID: 114370435
NCBI-ProteinID: XP_028183586
Position
10
AA seq 365 aa AA seqDB search
MQFKCFSCFLCEKEQSEIQNANKKNRDYPWEIYTLKELLRATNNFHQDSKIGEGGFGSVY
WGRTSKGVEIAVKRLKTMTAKAEMEFAVEVEVLGRVRHKNLLGLRGFYAGGDERLIVYDY
MPNHSLLTHLHGQLATDCLLDWPRRMSIAIGAAEGLVYLHHEANPHIIHRDIKASNVLLD
TEFEAKVADFGFAKLIPEGVSHLTTRVKGTLGYLAPEYAMWGKVSGSCDVYSFGILLLEI
VSAKKPIEKLPGGVKRDIVQWVTPHVQKGNFIHIADPKLKGHFDLEQLKSVVMIAMRCTD
NSPEKRPTMQEVVEWLKGGIGRRKKEIPYLSYKTEDDKYEENYGEIRTTQSKFKIASDND
KLKIR
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgcagtttaaatgtttcagttgttttctttgtgaaaaggagcaatcagaaatacagaat
gccaacaagaaaaatagggactatccatgggaaatatacaccttgaaggagttgcttcgt
gcaacaaacaattttcatcaagatagcaagataggagagggtggatttggaagtgtttat
tggggtcgaacaagtaaaggcgtcgagattgcagtgaagcgcttgaagactatgactgca
aaggcagagatggagtttgcagttgaagtggaagtactaggaagagtgaggcataagaat
ttgttaggcttgcgtggattctatgcaggaggcgatgaacggttgattgtctatgattac
atgcctaatcacagtttactcacccatttgcatggtcaacttgccacggattgtttacta
gattggcctagaagaatgagtatagcaattggagctgcagaaggcttagtgtatttgcac
catgaagcaaatcctcacatcattcatagagacataaaggcaagcaatgttcttttagac
actgaatttgaagccaaggttgctgatttcggttttgctaagttgataccagaaggtgta
agccatctcacaacaagggttaaaggcacccttggatatttggcgccagagtatgctatg
tgggggaaggtttctgggagctgtgatgtttacagttttgggattttgcttttggagatt
gtgagtgccaagaaaccaattgagaaactccctggtggagtgaaaagggacatagttcaa
tgggtcacaccacatgtccaaaagggtaacttcattcatattgctgatccaaagttgaag
gggcattttgatttagagcaattgaaatctgtggtcatgatagctatgaggtgcacagat
aatagcccagagaagaggcctaccatgcaagaggtggtggagtggctcaagggtggtata
gggagaagaaaaaaagagattccatatttgagttacaagactgaagatgacaaatatgag
gaaaactatggagagattagaacaacgcagtccaaattcaaaatagcaagtgataatgat
aaacttaaaataagataa

DBGET integrated database retrieval system