KEGG   Glycine soja (wild soybean): 114371631Help
Entry
114371631         CDS       T06057                                 

Definition
(RefSeq) probable serine/threonine-protein kinase WNK11
Organism
gsj  Glycine soja (wild soybean)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 114371631
NCBI-ProteinID: XP_028184807
Position
10
AA seq 107 aa AA seqDB search
MAPDLYDEDYTELVDIYSFGMCVLELVTVEIPYSECDNVDKIYKKMSSGVRPAALNKVKD
PEVKAFIEKCLAQPRARPFAAELLKDPFFDEIADDDDENDDCSCSYQ
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atggctccagacttatacgatgaagactacacagaattggtggacatatactcatttggg
atgtgtgtgttagagttggtgacagtagagattccttatagtgaatgtgacaatgttgat
aagatatacaagaagatgtcttctggagttagacctgctgccttgaacaaggtcaaagat
cctgaggttaaggctttcattgagaagtgccttgctcaaccaagggctaggccttttgca
gctgagcttctcaaagatcctttctttgatgagattgcagatgatgatgatgaaaatgat
gactgttcttgttcatatcaatag

DBGET integrated database retrieval system