KEGG   Glycine soja (wild soybean): 114375199Help
Entry
114375199         CDS       T06057                                 

Definition
(RefSeq) UDP-glycosyltransferase 79B30-like
  KO
K22794  flavonol-3-O-glucoside/galactoside glucosyltransferase [EC:2.4.1.239 2.4.1.-]
Organism
gsj  Glycine soja (wild soybean)
Pathway
gsj00944  Flavone and flavonol biosynthesis
Brite
KEGG Orthology (KO) [BR:gsj00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00944 Flavone and flavonol biosynthesis
    114375199
Enzymes [BR:gsj01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.239  flavonol-3-O-glucoside glucosyltransferase
     114375199
    2.4.1.-  
     114375199
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C
Motif
Other DBs
NCBI-GeneID: 114375199
NCBI-ProteinID: XP_028188767
Position
11
AA seq 319 aa AA seqDB search
MRQNMSESDLMQPPEGYPVSSVKLHAHEVKFLASKRDWEFGSGVLFYHRLNKGLIFSDAV
GFKGCREIEGPYVEYLAEQFGKPVLLSGPFIPEPPNTVFEGKWGSWLERFKLGSVVFCVL
GTEWKLPHDQFQGLLLGLELTGLPFLAVLKVPIGFETIEAALPEGFKERVEGRGIVHSGW
IQQQLILEHPSVGCFITHCGAGSLTEALVNKCQIVLLPQVDADHILNARTMATNKVGVEV
EKGEEDGLFTKESVCKAVKIVMDDENELGREIKTNHSKVRKFLLNHKLESTCVDSFCQQL
RHLLMISKFQETQLRLSYF
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgcgccaaaacatgtctgaaagtgatcttatgcaaccccctgaagggtaccctgtgtct
tccgtcaagcttcatgcacatgaagtcaagtttcttgcttctaaaagggattgggagttt
ggaagcggtgttctcttctaccaccgtctcaacaagggtttgatcttttcagacgctgtt
gggttcaaaggttgccgagaaattgaagggccttatgttgagtatcttgcagaacagttt
gggaagcctgttttgctttcaggacctttcatacctgagccacccaacactgtttttgag
ggaaaatggggttcatggcttgaaaggttcaagcttggttctgtggttttctgtgtactt
gggactgaatggaagttaccacatgatcaattccaaggactattgttgggtcttgaactt
acagggcttccttttttggctgttctaaaagttccaattgggtttgagacaattgaagct
gctctaccagaagggttcaaagaaagagttgaagggagaggaattgtccacagtggatgg
atacaacaacaattgattttggaacacccttcagtaggctgcttcattacgcattgtggt
gctggttcattaaccgaggcactagtaaataagtgtcagatagtgttgctgccgcaggta
gatgctgatcatatccttaatgcaaggactatggctacaaataaggttggggtggaagtg
gagaagggtgaagaagacgggttgttcacaaaggagagtgtgtgcaaagctgtgaaaatt
gtgatggatgatgagaatgagcttgggagagagataaagactaatcatagtaaagtgagg
aagttcttactgaaccacaagttggagtctacctgtgttgatagcttttgccagcagctt
cgacatttactcatgatttccaagtttcaagaaactcaactgagattatcatatttctag

DBGET integrated database retrieval system