KEGG   Glycine soja (wild soybean): 114379793Help
Entry
114379793         CDS       T06057                                 

Definition
(RefSeq) probable methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
gsj  Glycine soja (wild soybean)
Pathway
gsj00450  Selenocompound metabolism
gsj00970  Aminoacyl-tRNA biosynthesis
gsj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gsj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    114379793
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    114379793
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:gsj01007]
    114379793
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:gsj03016]
    114379793
Enzymes [BR:gsj01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     114379793
Amino acid related enzymes [BR:gsj01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   114379793
Transfer RNA biogenesis [BR:gsj03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    114379793
 Prokaryotic type
   Other AARSs
    114379793
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 C1_1 Anticodon_1 tRNA-synt_1e Viral_protease
Motif
Other DBs
NCBI-GeneID: 114379793
NCBI-ProteinID: XP_028194312
Position
12
AA seq 803 aa AA seqDB search
MAENLIAPKLPVEGKRNILITSALPYVNNVPHLGNIIGCVLSADVFARYCRLRGYNAIYI
CGTDEYGTATETKAMEENCSPKEICDKYHAIHKEVYNWFNISFDEFGRTSSPEQTEVCQA
IFRKIFENKWLSENTMQQLYCNTCERFLADRLVEGTCPTPGCEYDSARGDQCEKCGKLLN
PTELKNPRCKVCQKTPHIRDTDHLFLELPLLKDRLEKYISEMSVVGGWSQNAIQTTNSWL
REGLKPRCITRDLKWGVPVPHEKYSDKVFYVWFDAPIGYVSITSCYTREWEKWWKNPENV
ELYQFMGKDNVPFHTVMFPSTLLGTSENWTLMKTISVTEYLNYEAGKFSKSKGIGVFGND
AKDTNIPVEVWRYYLLTNRPEVSDTLFTWPDLQAKLNSELLNNLGNFINRVLSFIAKPAG
QGYDSIIPSVPDNVSGDSHGPTKKLADKVAAYIDQYIEAMEKVKLKQGLKTAMSISSEGN
AYLQEAEFWRLYKENKSLCSLVMKTAAGIVYLLACLLEPFIPSFTLEVFKQLNLPADTHV
SLSDDKGDVDRVKRPWDIISAGHKIGTPKPLFRELKDEEVEFYRKKFAGSQADRIVRAEA
EAQNVAEQLKKTKVSDGNGKKKPGKSSNEAKNKAAAEPDITITRLDIRVGLIIKAQKHPD
ADALYVEEIDVGEEQTRTVVSGLVKFIPLDEMQNRKVCVLCNLKPVTMRGIKSQAMVLAA
SDGDHTKVELVEPPSSAQPGERITFPGYEGNPDELLNPKKKVWETLQVDLHTNEELVACY
KNVPLTTSAGVCKVSSISCGSIR
NT seq 2412 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaatctgatagcgccgaagcttcccgtcgaaggaaagcgcaacattctcatc
accagtgccttgccttacgtcaacaacgttcctcacctcggcaacatcattggatgcgtg
ttgagtgctgatgtattcgctcgctactgtcggcttcgcggttataacgctatttacatc
tgcggtactgatgagtatggaactgccactgagactaaagccatggaagaaaactgctct
cccaaagagatttgtgacaaatatcatgctattcataaggaggtctacaattggttcaat
ataagttttgatgaatttggacggacgtcatcccctgagcaaactgaagtttgccaagca
attttcagaaagatattcgaaaacaagtggctatccgagaacacaatgcagcagctttac
tgcaacacctgtgaaaggttcttggctgataggcttgtggagggaacctgcccgactcct
ggctgcgagtatgattctgcccgaggagaccagtgtgagaagtgtggaaagcttttaaat
ccaacagaattgaaaaatcccagatgcaaggtttgtcagaaaactcctcatattcgtgat
acagatcacttgtttcttgaactccccctattaaaagatagattggaaaaatacatcagt
gagatgtctgtggttggtggatggagtcaaaatgctatccaaacaacaaattcatggctt
agagaagggttaaagccacgctgtattacgagggatctaaagtggggggttcctgttcca
catgaaaaatacagtgacaaggttttctatgtttggtttgatgcacctattggatatgtc
tcaattacttcgtgctacacacgtgaatgggagaaatggtggaaaaacccagagaatgtg
gagctgtatcagtttatgggcaaggacaatgtgccattccacactgtgatgtttccatct
actctacttggaactagtgaaaattggactttaatgaagactattagtgttactgaatac
ttgaattatgaagcagggaagttttctaagagcaaaggtattggggtttttggtaatgat
gcgaaagatactaatattccagttgaagtatggagatattacttgctcacaaataggccg
gaggtatcagatacgttatttacatggccggacttgcaagctaaactaaatagtgagtta
ctgaataatttgggcaactttatcaaccgagttttgagttttattgccaaacctgcaggg
caaggatatgattccattatcccctctgttcctgataatgtaagtggtgactcccatggt
ccgaccaaaaagttggctgataaagttgctgcatatatagaccaatacatagaagcaatg
gagaaggttaaactgaagcaagggttgaaaactgcaatgagcatatccagcgagggaaat
gcatatctgcaggaagctgaattctggcgcctctacaaggaaaacaaatctctctgctct
cttgtcatgaaaactgcagctgggattgtatatcttcttgcttgtttgttagaacctttt
atcccatctttcactcttgaagtatttaagcagctaaatttgcctgcggatacacatgtt
tcacttagtgatgataaaggagatgttgatagggtaaaaagaccctgggatatcataagt
gctggtcataaaattggaacacccaagccattgttcagggaactgaaagatgaagaggtg
gagttctacaggaagaagttcgcaggaagtcaagctgataggattgtgcgtgcagaggcc
gaagctcagaatgttgctgagcaactgaagaaaacgaaagtttcagatggcaatggaaag
aaaaaaccaggaaaatcatcaaatgaagccaaaaataaagctgctgctgaaccagatatt
accatcacaaggcttgatatccgggttggcctcataataaaagctcaaaaacatcctgat
gcagatgcactatatgttgaagagattgacgtcggtgaagaacagaccagaactgttgtc
agtgggcttgtcaaatttataccactcgatgaaatgcagaaccgaaaggtctgtgttctt
tgcaacctaaagccagtaaccatgaggggcattaaatctcaagcaatggttcttgctgct
tccgatggtgatcacaccaaggttgagttggttgagcctcccagttctgctcaaccagga
gaaagaattacattccctgggtatgaaggtaatcctgatgaactcttaaacccaaagaag
aaagtttgggaaacattgcaagtcgatttgcacacaaatgaggaactggtggcatgctac
aaaaatgttccactcaccacatcagctggcgtttgcaaggtttcatccataagctgtgga
tccataaggtag

DBGET integrated database retrieval system