KEGG   Glycine soja (wild soybean): 114380397Help
Entry
114380397         CDS       T06057                                 

Definition
(RefSeq) heat shock cognate 70 kDa protein 2
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
gsj  Glycine soja (wild soybean)
Pathway
gsj03040  Spliceosome
gsj04141  Protein processing in endoplasmic reticulum
gsj04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:gsj00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    114380397
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    114380397
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    114380397
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:gsj01009]
    114380397
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:gsj03041]
    114380397
   03009 Ribosome biogenesis [BR:gsj03009]
    114380397
   03110 Chaperones and folding catalysts [BR:gsj03110]
    114380397
   04131 Membrane trafficking [BR:gsj04131]
    114380397
   03051 Proteasome [BR:gsj03051]
    114380397
   03029 Mitochondrial biogenesis [BR:gsj03029]
    114380397
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gsj04147]
    114380397
Protein phosphatases and associated proteins [BR:gsj01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     114380397
Spliceosome [BR:gsj03041]
 Complex B
  Other components
   Prp19 complex
    114380397
 Complex C
   Prp19-CDC5 complex
    114380397
Ribosome biogenesis [BR:gsj03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    114380397
Chaperones and folding catalysts [BR:gsj03110]
 Heat shock proteins
  HSP70 / DNAK
   114380397
Membrane trafficking [BR:gsj04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    114380397
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    114380397
Proteasome [BR:gsj03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    114380397
Mitochondrial biogenesis [BR:gsj03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    114380397
Exosome [BR:gsj04147]
 Exosomal proteins
  Proteins found in most exosomes
   114380397
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 114380397
NCBI-ProteinID: XP_028195225
Position
12
AA seq 649 aa AA seqDB search
MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
QVAMNPINTVFDAKRLIGRRFSDASVQSDMKLWPFKVIPGPADKPMIVVNYKGDEKQFSA
EEISSMVLIKMKEIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP
TAAAIAYGLDKKATSSGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD
NRMVNHFVQEFKRKNKKDISGNARALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFY
TTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQDFF
NGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLI
PRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQI
TVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKK
KVEAKNTLENYAYNMRNTIKDDKIASKLSADDKKKIEDAIEQAIQWLDGNQLAEADEFED
KMKELESICNPIIAKMYQGAGGDAGGAMDEDGPAAGSGSGAGPKIEEVD
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atggctggaaaaggcgagggtcctgctatcggaatcgatttgggaacgacgtactcttgc
gtcggcgtgtggcaacacgatcgtgttgaaatcatagccaacgaccagggtaacagaact
accccatcctacgtggctttcaccgacacagaacggttgatcggcgatgcggcgaagaac
caggtcgctatgaacccaatcaacactgtttttgatgctaagcgtttgattggaagacgt
ttttctgatgcatcggtacaaagtgacatgaaactgtggccgtttaaggttattcctggc
cctgctgacaagcctatgattgtggtgaattacaagggggatgagaagcagttttcggcg
gaagagatatcttccatggttcttataaagatgaaggagatcgcggaggcgtatctagga
tcgacgataaagaatgcagttgtcaccgtccctgcttacttcaacgactcacagcgtcaa
gctacaaaggacgctggtgtcatttccgggctcaacgtgatgcgaattatcaacgagcct
acagcggccgccattgcttatggactcgacaagaaggccactagctctggggagaagaat
gttctcatcttcgacctcggtggtgggacttttgatgtctcccttctcaccattgaggag
ggtattttcgaagtgaaagccactgctggtgatactcacttgggaggtgaagattttgat
aacagaatggtgaaccattttgttcaggaattcaagaggaagaacaagaaggatattagt
ggaaatgccagagcattgaggaggttgagaacagcatgtgagagggccaagagaactctc
tcttccactgctcaaaccaccattgagattgattccttgtatgagggtattgacttctac
acaaccatcacccgtgcccgtttcgaagagcttaacatggacctattcaggaagtgcatg
gagcccgtggagaagtgtttgcgggatgctaagatggacaagagcaccgtccatgatgtt
gttcttgtcggtggttctactaggattcccaaggttcaacagttgttgcaggacttcttc
aacggaaaggagctttgcaagagcattaacccagatgaagctgttgcctatggtgcagca
gtgcaggctgccattctcagtggcgagggtaatgagaaagtgcaggatcttctgttgttg
gatgttactcctctctcccttgggttggagaccgcaggaggagtcatgactgtgttgatt
cccagaaacacaaccattcccaccaagaaggagcaggtattttcgacctattccgacaac
cagcctggtgtgttgattcaggtctatgaaggtgaacgtacgaggactcgtgataacaat
ttgcttggcaaatttgagttatctggaattcctcctgctccgagaggtgttcctcagatc
accgtttgctttgacattgacgccaacggtatattgaacgtgtctgcggaggacaaaacc
actggacagaagaacaagattacaattaccaacgacaaaggaaggctttctaaggaggag
attgagaagatggtgcaggaagctgagaagtacaaggctgaggatgaggagcataagaag
aaagtggaggccaaaaatacattggagaattacgcctataacatgaggaacacaattaaa
gatgataagattgcttccaagctgtctgctgatgataagaagaaaattgaggatgcaatt
gagcaggctatccaatggctcgatggaaaccaacttgctgaagctgacgaattcgaggac
aagatgaaggagttggagagcatttgtaaccccatcatagcaaagatgtaccaaggagct
ggtggtgatgcgggtggagccatggatgaggatggtcctgctgctggcagtggaagcggt
gctggacccaaaattgaggaagtcgattaa

DBGET integrated database retrieval system