KEGG   Glycine soja (wild soybean): 114380725
Entry
114380725         CDS       T06057                                 

Definition
(RefSeq) delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
gsj  Glycine soja (wild soybean)
Pathway
gsj00100  Steroid biosynthesis
gsj01100  Metabolic pathways
gsj01110  Biosynthesis of secondary metabolites
Module
gsj_M00917  Phytosterol biosynthesis, squalene 2,3-epoxide => campesterol/sitosterol
Brite
KEGG Orthology (KO) [BR:gsj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    114380725
Enzymes [BR:gsj01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     114380725
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 114380725
NCBI-ProteinID: XP_028195540
Position
13
AA seq 374 aa
MMESHVDLGFLLQALTPSWNSVPLLVGFFTYLAVAGSILPGKLVPGVALLDGTRLHYRCN
GLLSLLLLVALLGIGAKMGFVSPTAISDRGLELLSTTFAFSFLVTLILHFSGCKSQSKGS
SLKPHLSGNLIHDWWFGIQLNPQFMGIDLKFFFVRAGMMGWLLINLSILMKSIQDGTLSQ
SMILYQLFCALYILDYFVHEEYMTSTWDIIAERLGFMLVFGDLVWIPFSFSIQGWWLLMN
SVELTPAAIVANCFVFLIGYMVFRGANKQKHVFKKNPKAPIWGKPPKVIGGKLLASGYWG
IARHCNYLGDLMLALSFSLPCGISSPIPYFYPIYLLILLIWRERRDEARCAEKYREIWAE
YRKLVPWRILPYVY
NT seq 1125 nt   +upstreamnt  +downstreamnt
atgatggagtcacacgtggatctaggttttctccttcaagctctcactccatcttggaac
tccgttcctttgcttgtggggttcttcacttacttggccgttgctggatccattctccct
ggaaaacttgttcctggcgttgcactactcgatgggactcgtctacactatcgctgcaat
ggtctgctctcgcttcttctgttggttgcacttctcgggatcggtgccaagatgggtttt
gtgtctcccactgccatatcagacagaggacttgagctgctgtccacgacttttgccttc
agttttcttgtaaccctgatattgcatttttccggttgcaagtcacaaagtaaaggttca
tcactaaagcctcatctcagtggaaacctgatacacgattggtggtttggtatacaacta
aatccacagttcatgggtattgacctcaaatttttctttgttagagctggaatgatggga
tggctacttatcaatttatctattcttatgaagagcattcaagatggtactttgagccag
tcaatgattctctaccagctattctgtgcactatacatcctggactattttgtacatgaa
gagtacatgacatccacctgggacataattgcagagagactgggcttcatgttggtcttt
ggagatttagtgtggattcctttctctttcagcatacagggatggtggctcttgatgaac
agtgtggagttaacaccagctgccattgtagctaattgctttgtgttcctgattggatac
atggtatttcgaggagcaaacaagcaaaagcatgtgttcaaaaagaatccaaaggctcct
atctggggtaagcctccaaaagtcattggtggaaagctacttgcttctggttattggggt
attgctagacactgtaattacctaggggatttgatgcttgctctctccttcagcttacca
tgtgggataagttcaccaattccatacttctatccaatttatcttcttattctgttaatc
tggagagagagaagggatgaagctcgttgcgccgagaagtatagagagatatgggccgag
tatcgtaaacttgttccatggagaatattgccttacgtttattag

DBGET integrated database retrieval system